KEGG   Micromonas pusilla: MICPUCDRAFT_35319Help
Entry
MICPUCDRAFT_35319 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mpp  Micromonas pusilla
Pathway
mpp00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MICPUCDRAFT_35319
Enzymes [BR:mpp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MICPUCDRAFT_35319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 9686918
NCBI-ProteinID: XP_003061716
JGI: 35319
UniProt: C1N0Y7
AA seq 305 aa AA seqDB search
MDVEAFVLTVAAAVALTIVLLDFVFGSARTRRKTTLDAKNPTKKVALRLESKTELSHDTY
LFRFALPSPEHVLGLPIGQHVALSYIDDDGKEQSRPYTPTSSDVDRGRVDFVIKVYFKCD
KFPDGGKVSQRMHALKVGDTMDFQGPKGRFEYRGRGVFAIKRLKSQGGGHELRRARRVGM
IAGGTGITPMLQVMRAAFRDQPGDATKLSLLFANQTEDDILLKDELDACERDHENFVAHY
TIDKAKRKGWTGSTGFVTAEMIKEHMPPPGPDTQILLCGPPPMMKYAVLPAFEKLGYTKE
MFLQW
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgaggcgttcgtcctcaccgtcgccgccgcggtcgcgctgacgatcgtcctc
ctcgacttcgtcttcggatccgctcgaacacgacgaaagacgacgctggacgcgaagaac
ccgacgaagaaggtcgcgctcagactcgagtccaagacggagctgtcgcacgacacgtac
ctgttccggttcgcgctgccgtcgccggaacacgtcctcggcctcccgatcgggcagcac
gtcgcgctgtcgtacatcgacgacgacgggaaggagcaatcgcggccgtacacgccgacg
tccagcgacgtcgaccgcgggcgcgtcgactttgtgatcaaggtttacttcaagtgcgac
aagttcccggacggcgggaaggtgtcgcagcgcatgcacgcgctgaaggttggggacacg
atggatttccaaggcccgaaaggccggttcgagtaccgcggccgcggcgtcttcgccatc
aagcgcctcaagtcgcagggcggcgggcacgagctacggcgcgcgagacgcgtcggcatg
atcgcgggcgggacggggataacgccgatgctgcaggtgatgcgcgcggcgtttagggac
cagccgggcgacgcgacgaagctgtcgctgctgttcgcgaaccagaccgaggacgacatc
ttgctcaaggacgagctggacgcgtgcgagagggatcacgagaacttcgtcgcgcactac
acgatcgacaaggcgaagaggaaagggtggacggggagcacggggttcgtcaccgcggag
atgatcaaagagcacatgccgccgccggggccggacacgcagattttgttgtgcgggccg
ccgccgatgatgaaatacgcggtcctccccgcgttcgagaagctggggtacacgaaggag
atgtttcttcagtggtga

DBGET integrated database retrieval system