KEGG   Micromonas pusilla: MICPUCDRAFT_35610Help
Entry
MICPUCDRAFT_35610 CDS       T02696                                 

Gene name
HEMG
Definition
protoporphyrinogen IX oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mpp  Micromonas pusilla
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MICPUCDRAFT_35610 (HEMG)
Enzymes [BR:mpp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MICPUCDRAFT_35610 (HEMG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 541 aa AA seqDB search
MPTTTTRASSSFAPSPRSFRAVRAVTRHAPSARASRLNVRASGSADAAYDAVVIGAGVSG
LSTAFTLGRKSPGTRTLVTEARDRVGGNITTRSENGYVWEEGPNSYQPGDAILTVACDAG
MRDDILLADPNSDRYVLWDGELRALPKDIPTAVLGTFLTWPGKIRAGLGAIGIRPPPPEG
KEESVKEFVSRNLGVEAFERLIEPFCSGVYAGDPAMLSSVAATGRVQRLEPLGGSLVAGA
LKAQKEAYDAMKARGPRDPRLPKVEGQTVGSFRGGLKTFPEGLARALGPEVVKLEWKVTQ
ITKNADGDGFDIAYDTPEGAKTITSHSVVMTAPAYVTSKVVEAMAPAASAALDKFYYPPV
ASVTVSYPKDAFRLDGTSALPEGGLTGFGQLHPRSQGIRTLGTIYSSSLFKDDKRQPDGE
FMILNYIGGARDTAVKDMTDEALVTAIHEDALKTILKPGTPPPKVVGVKVWEKAIPQFNV
GHLDVLADAKRGLKEAGCDGLFLGGNYTAGVALGRCVEFGVEQAAELETYIASVKAKELA
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgacgacgacgcgcgcgtcctcctccttcgcgccctccccgagatcgttccgc
gccgtccgcgcggtgacgcgtcacgcgccgtccgcgcgcgcgtccaggctcaacgtccgc
gcgtcaggcagcgcggacgccgcgtacgacgccgtcgtcatcggcgcgggcgtctccggc
ctcagcaccgcgttcacgctcggaaggaagagcccggggacgcgaacgctcgtcacggaa
gcgcgcgatcgcgtcggcgggaacatcacgacgcgcagcgagaacggctacgtgtgggag
gaaggcccgaactcgtaccagccgggcgacgcgatcctcaccgtggcgtgcgacgcgggg
atgcgcgacgacatcctcctcgcggatccgaacagcgatcggtacgtgctctgggacggc
gagctcagagcgttgcccaaagatattcccaccgcggttctcgggacgtttctgacgtgg
cccgggaagatccgcgccggcctcggcgcgatcgggatccgcccgccgccgccggagggg
aaggaggagtccgtgaaggagttcgtgtcacggaacttgggcgtcgaggcgttcgagcgt
ctcatcgagccgttctgctcgggcgtctacgcgggcgatcccgcgatgttgtcctccgtc
gccgccaccgggagggtgcagcgcctcgagccgctcggcgggtcgctcgtcgcgggcgcg
ctgaaggcgcagaaggaggcgtacgacgcgatgaaggcgagagggccgcgcgatccgagg
ctgccgaaggtggagggccagacggtgggatcgttccgcggcggattgaagacgtttccg
gaggggctcgcgagagcgctcggcccggaggtggtcaagctcgagtggaaagtgacgcaa
atcacgaagaacgccgacggcgacgggttcgacatcgcgtacgatacccccgagggcgcg
aagacgatcacgagccactccgtcgtgatgaccgcgcccgcgtacgtgacgtcgaaggtg
gtggaggcgatggcgccggcggcgtcggcggctttggataaattttattatccgcccgtc
gcgtcggtgacggtgtcgtacccgaaggacgcgttccgattggacggcacgagcgcgctt
ccggagggcgggctgaccgggttcgggcagctgcacccgcggagccaagggattcgcacg
ctcgggacgatctactcgtcgtccctgttcaaagacgacaagaggcagccggacggcgag
ttcatgatcttgaactacatcggcggcgcgcgcgacactgcggtgaaggacatgaccgac
gaggcgctcgtgacggcgatccacgaggacgcgctgaagacgatcctgaagcccgggacg
ccgccgcccaaggtggtcggcgtgaaggtgtgggagaaggcgattccgcagttcaacgtc
ggacacctcgacgtgctcgccgacgccaagagagggctgaaggaagccgggtgcgacggg
ctgttcctcggcgggaactacaccgccggcgtcgcgttggggcggtgcgtggagtttggc
gtggagcaagccgcggaactggagacgtacatcgcgagcgtgaaggcgaaagagctcgcg
cgttga

DBGET integrated database retrieval system