KEGG   Micromonas pusilla: MICPUCDRAFT_35610Help
Entry
MICPUCDRAFT_35610 CDS       T02696                                 

Gene name
HEMG
Definition
protoporphyrinogen IX oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mpp  Micromonas pusilla
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mpp00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 541 aa AA seqDB search
MPTTTTRASSSFAPSPRSFRAVRAVTRHAPSARASRLNVRASGSADAAYDAVVIGAGVSG
LSTAFTLGRKSPGTRTLVTEARDRVGGNITTRSENGYVWEEGPNSYQPGDAILTVACDAG
MRDDILLADPNSDRYVLWDGELRALPKDIPTAVLGTFLTWPGKIRAGLGAIGIRPPPPEG
KEESVKEFVSRNLGVEAFERLIEPFCSGVYAGDPAMLSSVAATGRVQRLEPLGGSLVAGA
LKAQKEAYDAMKARGPRDPRLPKVEGQTVGSFRGGLKTFPEGLARALGPEVVKLEWKVTQ
ITKNADGDGFDIAYDTPEGAKTITSHSVVMTAPAYVTSKVVEAMAPAASAALDKFYYPPV
ASVTVSYPKDAFRLDGTSALPEGGLTGFGQLHPRSQGIRTLGTIYSSSLFKDDKRQPDGE
FMILNYIGGARDTAVKDMTDEALVTAIHEDALKTILKPGTPPPKVVGVKVWEKAIPQFNV
GHLDVLADAKRGLKEAGCDGLFLGGNYTAGVALGRCVEFGVEQAAELETYIASVKAKELA
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgacgacgacgcgcgcgtcctcctccttcgcgccctccccgagatcgttccgc
gccgtccgcgcggtgacgcgtcacgcgccgtccgcgcgcgcgtccaggctcaacgtccgc
gcgtcaggcagcgcggacgccgcgtacgacgccgtcgtcatcggcgcgggcgtctccggc
ctcagcaccgcgttcacgctcggaaggaagagcccggggacgcgaacgctcgtcacggaa
gcgcgcgatcgcgtcggcgggaacatcacgacgcgcagcgagaacggctacgtgtgggag
gaaggcccgaactcgtaccagccgggcgacgcgatcctcaccgtggcgtgcgacgcgggg
atgcgcgacgacatcctcctcgcggatccgaacagcgatcggtacgtgctctgggacggc
gagctcagagcgttgcccaaagatattcccaccgcggttctcgggacgtttctgacgtgg
cccgggaagatccgcgccggcctcggcgcgatcgggatccgcccgccgccgccggagggg
aaggaggagtccgtgaaggagttcgtgtcacggaacttgggcgtcgaggcgttcgagcgt
ctcatcgagccgttctgctcgggcgtctacgcgggcgatcccgcgatgttgtcctccgtc
gccgccaccgggagggtgcagcgcctcgagccgctcggcgggtcgctcgtcgcgggcgcg
ctgaaggcgcagaaggaggcgtacgacgcgatgaaggcgagagggccgcgcgatccgagg
ctgccgaaggtggagggccagacggtgggatcgttccgcggcggattgaagacgtttccg
gaggggctcgcgagagcgctcggcccggaggtggtcaagctcgagtggaaagtgacgcaa
atcacgaagaacgccgacggcgacgggttcgacatcgcgtacgatacccccgagggcgcg
aagacgatcacgagccactccgtcgtgatgaccgcgcccgcgtacgtgacgtcgaaggtg
gtggaggcgatggcgccggcggcgtcggcggctttggataaattttattatccgcccgtc
gcgtcggtgacggtgtcgtacccgaaggacgcgttccgattggacggcacgagcgcgctt
ccggagggcgggctgaccgggttcgggcagctgcacccgcggagccaagggattcgcacg
ctcgggacgatctactcgtcgtccctgttcaaagacgacaagaggcagccggacggcgag
ttcatgatcttgaactacatcggcggcgcgcgcgacactgcggtgaaggacatgaccgac
gaggcgctcgtgacggcgatccacgaggacgcgctgaagacgatcctgaagcccgggacg
ccgccgcccaaggtggtcggcgtgaaggtgtgggagaaggcgattccgcagttcaacgtc
ggacacctcgacgtgctcgccgacgccaagagagggctgaaggaagccgggtgcgacggg
ctgttcctcggcgggaactacaccgccggcgtcgcgttggggcggtgcgtggagtttggc
gtggagcaagccgcggaactggagacgtacatcgcgagcgtgaaggcgaaagagctcgcg
cgttga

DBGET integrated database retrieval system