KEGG   Micromonas pusilla: MICPUCDRAFT_4458Help
Entry
MICPUCDRAFT_4458  CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
Organism
mpp  Micromonas pusilla
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 289 aa AA seqDB search
KKVLWSDVLYSPKREAFLRKWMPTDITYASFIGAMHAGCLLAPFTFTWSAFNCFLVMYFI
TGCLGITLSYHRQLSHKSFTTPKWLEYALAYCGAMAVQGDPLEWASSHRHHHQHCDTPKD
PHTPYEGFWWSHCGWLLDNEATLKRVGDRSNAKELAEQPFYQFMEKTYMWHVLAWALAFY
AIGGLPWLVWGFCVRTCWVYHITWAVNSVAHVWGSQTFNTGDLSRNNWWIGVLAFGEGWH
NNHHAFEFSARHGLEWWQIDMTWWCVCVLKFLGLADKVKLPSEKQMDRI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
aaaaaagtcctctggtcggacgtcctctactccccgaagcgcgaggcgttccttcgcaag
tggatgcccacggacatcacgtacgcgtccttcatcggcgccatgcacgccggctgcctc
ctcgcgccgttcacgttcacctggagcgcgttcaactgcttcctcgtgatgtacttcatc
accggatgcttaggcatcacgctgtcgtaccaccgccagctgtcgcacaagtcgttcacg
acgcccaagtggctggagtacgcgctcgcgtactgcggcgcgatggcggtccagggcgac
ccgctcgagtgggcgtcgtcgcaccgccaccaccaccagcactgcgacacgccgaaggac
ccgcacacgccgtacgaagggttttggtggtcgcactgcgggtggctgctggacaacgag
gcgacgttgaagcgcgtcggcgatcgcagcaacgcgaaggagctcgcggagcagccgttt
tatcagttcatggagaagacgtacatgtggcacgtcctcgcgtgggcgctcgcgttttac
gcgatcggcgggttgccgtggctggtgtggggtttctgcgtgaggacgtgttgggtgtat
cacatcacgtgggcggtgaatagcgtcgcgcacgtgtggggttcgcagacgttcaacacc
ggggatctgtcacggaacaactggtggatcggcgtgttagcgttcggggaggggtggcac
aacaaccatcacgcgtttgagttcagcgcgaggcacgggttggagtggtggcaaatcgac
atgacgtggtggtgcgtctgcgtcttgaagtttttgggactcgcggacaaggtgaagctt
ccgagcgagaagcagatggatcgcatc

DBGET integrated database retrieval system