KEGG   Micromonas pusilla: MICPUCDRAFT_45330Help
Entry
MICPUCDRAFT_45330 CDS       T02696                                 

Definition
histone acetyltransferase
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
mpp  Micromonas pusilla
Brite
Enzymes [BR:mpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MICPUCDRAFT_45330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 447 aa AA seqDB search
MTGKENDTPKTEKQDGEEKQEKKAHHTGGNARPPVDTSLLPPKPKEEDVVKVKHAASGVM
LPLDVGARVSCRWRDGQMYPVRVIERRAGPKGVLGQEEYEYYVHYEQFNRRLDTWVTIAD
MDLDTAETDDDKKKRKAEEVDEEHADFDPNALREHEECTKVRNILSVELGRHQMDTWYFS
PFPPEYTTCKKLYFCEFTLNFFKRKEQLQRHLRKNEMYHPPGDEIYRNETRGRTAAFFEI
DGKKDKIFCQNLCYLAKLFLDHKTLYYDVDLFLFYVLCEVDERGYHIVGYFSKEKCSEEG
YNLACILTLPAYQRKGYGKMLISFSYELSKKEGKVGTPERPLSDLGLVSYRGYWTRELLA
ILKDPSRAVMSIKDLSELTMIKTEDIISTLQHLNLLAYQKGAYVICAAPEIIEKHLKEAG
SPGVEVDPSKLIWTPYNAEKEYQNFRG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaaggaaaacgacacgccgaagacggagaagcaggatggcgaggaaaagcag
gaaaagaaggcgcaccacaccggcggcaacgcccgcccgcccgtggacacctccctcctc
cccccgaagcccaaagaggaggacgtcgtgaaggtcaagcacgcggcgtcgggcgtgatg
cttccgctcgacgtcggcgcgcgcgtgagctgccgttggcgcgacggccagatgtatccg
gtgcgcgtgatcgagcgcagggctgggccgaagggcgtcctggggcaggaggagtacgag
tactacgtgcactacgagcagtttaatcggcggttggacacgtgggtgacgatcgcggac
atggatctcgacacggcggagacggatgacgacaagaagaagcgcaaggcggaggaggtg
gacgaggagcacgcggatttcgacccgaacgcgctgagggagcacgaggagtgcacgaag
gtgcgcaacatcttgtccgtggagctggggaggcatcagatggacacgtggtacttctcg
ccgttcccgcccgagtacacgacgtgcaagaagctctacttttgcgagttcacgctcaac
tttttcaagcggaaagagcagctgcaacggcacctgcgcaaaaacgagatgtaccacccg
cccggggacgagatctatcgcaacgagacgcgagggcggaccgcggcgttcttcgagatc
gacggcaagaaggacaagatcttctgccagaacctgtgctacctcgcgaagttattcctg
gaccacaagacgctgtactacgacgtcgacttgtttctgttttacgtcttgtgcgaggtg
gacgagcgagggtatcacatcgtcggctacttctccaaggagaagtgctccgaggaaggg
tacaacctcgcgtgcatcctcacgctcccggcgtaccagcggaaaggctacggcaagatg
ctcatctcgttctcgtacgagctctcgaagaaggaggggaaggttggcacgcccgagcgg
ccgctgtccgatctcggcctcgtgtcctaccgcgggtactggacgcgcgagctgctcgcc
atcttaaaagacccgtcccgcgcggtcatgtccatcaaggacctcagcgagctcacgatg
atcaagaccgaggacatcatatcgacgctgcagcacttgaacctcttggcgtatcagaag
ggcgcgtacgtgatctgcgcggcgccggagatcatcgagaagcacctcaaggaggcgggg
tcgccgggcgtggaggtggatccgtcgaagctgatctggacgccgtacaacgcggagaag
gagtaccagaacttccgcgggtga

DBGET integrated database retrieval system