KEGG   Micromonas pusilla: MICPUCDRAFT_46391Help
Entry
MICPUCDRAFT_46391 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
mpp  Micromonas pusilla
Pathway
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MICPUCDRAFT_46391
   01210 2-Oxocarboxylic acid metabolism
    MICPUCDRAFT_46391
   01230 Biosynthesis of amino acids
    MICPUCDRAFT_46391
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MICPUCDRAFT_46391
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MICPUCDRAFT_46391
Enzymes [BR:mpp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MICPUCDRAFT_46391
Amino acid related enzymes [BR:mpp01007]
 Aminotransferase (transaminase)
  Class I
   MICPUCDRAFT_46391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 477 aa AA seqDB search
MSTITVDNINAKVREMQYAVRGAIVQRAGEIEDGLKADPSKYPFDKVVYCNIGNPQSLGQ
KPISFFRQVLALCDYPDLLLAPGIEKTFPEDVRKIAKDILDNTTGGTGAYSHSQGVAFMR
KMVAAGISDRDGHPCDVNDLWLTDGASVGCHYLMKTLITDERDAVLTPIPQYPLYSACLA
LYGGTLLPYYLREEQGWALDVAELKSQTDKARGEGKNVRALVIINPGNPTGAALGLDNQK
EIVQFCKDEGILLVADEVYQENVYAEGKSFTSFKKVVRDLGVDIPIVSLNSTSKGFFGEC
GRRGGYMEVCGIDKGVAEQLYKLSSVGLCSNLAGQIVMALVMKPPKEGDASYPLYKQEKD
DILSSLKRRAVTLVNGLNALEGVSCQEAEGAMYAFPKIDLPAKFLKEAEGSGMAPDALYC
MRLLEATGIVVVPGSGFGQVEGTWHFRTTFLPAEADIEGVVQKMTKFHGDFMDAYRN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgatcaccgtcgataacatcaacgccaaggtgcgcgagatgcaatacgccgtg
agaggcgcgatcgtgcagcgcgcgggcgagatcgaggacgggctgaaggcggacccgtcg
aagtatccgttcgataaggtggtgtactgcaacatcggaaacccgcagtcgctcgggcag
aagcccatctcgttctttcgccaggtcctcgcgttgtgcgattacccggacctcctcctc
gcgcccgggatcgagaagacgttcccggaggacgtgagaaagatcgcgaaggatatcctg
gacaacaccacgggcggcaccggggcgtactcccactcccagggcgtggcgttcatgcgt
aagatggtcgcggctgggatctcggatcgcgacgggcacccgtgcgacgtcaacgatctg
tggctcaccgacggcgcgtccgtgggctgccactacctcatgaagacgctcatcacggac
gagcgcgacgcggtgttgacgccgatcccgcagtaccctctgtattccgcgtgtctcgcg
ctgtacggcgggacgttgctgccgtattacctccgcgaggagcagggttgggcgctcgac
gtggcggagttgaaatcgcagacggacaaggcgagaggcgaggggaagaacgtccgcgcg
ctcgtgatcatcaaccccgggaacccgaccggcgcggcgctcggtttagataaccagaag
gagatcgtgcagttttgcaaggacgagggcatcctcctcgtcgcggacgaggtgtaccaa
gagaacgtgtacgccgagggtaagagcttcacgtctttcaaaaaagtcgtccgcgacttg
ggcgtcgacatcccgatcgtttccctgaacagcacgtcgaaagggttcttcggcgagtgc
ggccgccgcggcgggtacatggaagtgtgcgggatcgacaagggcgtcgcggagcagctg
tataagctgtcgtcggtcggtttgtgctcgaacctcgccgggcaaatcgtgatggcgctc
gtgatgaagcccccgaaggaaggcgacgcgtcgtacccgctgtacaagcaagagaaggac
gacatcttgtcctcgttgaagcgccgcgcggtcacgctcgtgaacggcctgaacgcgctc
gagggcgtgtcgtgccaggaagccgagggcgcgatgtacgcgttcccgaagattgacctt
cccgcgaagtttttaaaagaagccgagggcagcggcatggcgccggacgcgttgtattgc
atgcgtctgctggaagcgaccgggatcgtcgtcgtcccgggcagcgggttcggccaggta
gaggggacgtggcacttcaggacgacgttccttcccgcggaggcggacatcgagggcgtc
gtgcagaagatgaccaagttccacggcgatttcatggacgcgtacaggaattaa

DBGET integrated database retrieval system