KEGG   Micromonas pusilla: MICPUCDRAFT_46391Help
Entry
MICPUCDRAFT_46391 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
mpp  Micromonas pusilla
Pathway
mpp00220  Arginine biosynthesis
mpp00250  Alanine, aspartate and glutamate metabolism
mpp00710  Carbon fixation in photosynthetic organisms
mpp01100  Metabolic pathways
mpp01200  Carbon metabolism
mpp01210  2-Oxocarboxylic acid metabolism
mpp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MICPUCDRAFT_46391
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MICPUCDRAFT_46391
   00220 Arginine biosynthesis
    MICPUCDRAFT_46391
Enzymes [BR:mpp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MICPUCDRAFT_46391
Amino acid related enzymes [BR:mpp01007]
 Aminotransferase (transaminase)
  Class I
   MICPUCDRAFT_46391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 9681249
NCBI-ProteinID: XP_003055208
JGI: 46391
UniProt: C1MIX0
AA seq 477 aa AA seqDB search
MSTITVDNINAKVREMQYAVRGAIVQRAGEIEDGLKADPSKYPFDKVVYCNIGNPQSLGQ
KPISFFRQVLALCDYPDLLLAPGIEKTFPEDVRKIAKDILDNTTGGTGAYSHSQGVAFMR
KMVAAGISDRDGHPCDVNDLWLTDGASVGCHYLMKTLITDERDAVLTPIPQYPLYSACLA
LYGGTLLPYYLREEQGWALDVAELKSQTDKARGEGKNVRALVIINPGNPTGAALGLDNQK
EIVQFCKDEGILLVADEVYQENVYAEGKSFTSFKKVVRDLGVDIPIVSLNSTSKGFFGEC
GRRGGYMEVCGIDKGVAEQLYKLSSVGLCSNLAGQIVMALVMKPPKEGDASYPLYKQEKD
DILSSLKRRAVTLVNGLNALEGVSCQEAEGAMYAFPKIDLPAKFLKEAEGSGMAPDALYC
MRLLEATGIVVVPGSGFGQVEGTWHFRTTFLPAEADIEGVVQKMTKFHGDFMDAYRN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgatcaccgtcgataacatcaacgccaaggtgcgcgagatgcaatacgccgtg
agaggcgcgatcgtgcagcgcgcgggcgagatcgaggacgggctgaaggcggacccgtcg
aagtatccgttcgataaggtggtgtactgcaacatcggaaacccgcagtcgctcgggcag
aagcccatctcgttctttcgccaggtcctcgcgttgtgcgattacccggacctcctcctc
gcgcccgggatcgagaagacgttcccggaggacgtgagaaagatcgcgaaggatatcctg
gacaacaccacgggcggcaccggggcgtactcccactcccagggcgtggcgttcatgcgt
aagatggtcgcggctgggatctcggatcgcgacgggcacccgtgcgacgtcaacgatctg
tggctcaccgacggcgcgtccgtgggctgccactacctcatgaagacgctcatcacggac
gagcgcgacgcggtgttgacgccgatcccgcagtaccctctgtattccgcgtgtctcgcg
ctgtacggcgggacgttgctgccgtattacctccgcgaggagcagggttgggcgctcgac
gtggcggagttgaaatcgcagacggacaaggcgagaggcgaggggaagaacgtccgcgcg
ctcgtgatcatcaaccccgggaacccgaccggcgcggcgctcggtttagataaccagaag
gagatcgtgcagttttgcaaggacgagggcatcctcctcgtcgcggacgaggtgtaccaa
gagaacgtgtacgccgagggtaagagcttcacgtctttcaaaaaagtcgtccgcgacttg
ggcgtcgacatcccgatcgtttccctgaacagcacgtcgaaagggttcttcggcgagtgc
ggccgccgcggcgggtacatggaagtgtgcgggatcgacaagggcgtcgcggagcagctg
tataagctgtcgtcggtcggtttgtgctcgaacctcgccgggcaaatcgtgatggcgctc
gtgatgaagcccccgaaggaaggcgacgcgtcgtacccgctgtacaagcaagagaaggac
gacatcttgtcctcgttgaagcgccgcgcggtcacgctcgtgaacggcctgaacgcgctc
gagggcgtgtcgtgccaggaagccgagggcgcgatgtacgcgttcccgaagattgacctt
cccgcgaagtttttaaaagaagccgagggcagcggcatggcgccggacgcgttgtattgc
atgcgtctgctggaagcgaccgggatcgtcgtcgtcccgggcagcgggttcggccaggta
gaggggacgtggcacttcaggacgacgttccttcccgcggaggcggacatcgagggcgtc
gtgcagaagatgaccaagttccacggcgatttcatggacgcgtacaggaattaa

DBGET integrated database retrieval system