KEGG   Micromonas pusilla: MICPUCDRAFT_46391Help
Entry
MICPUCDRAFT_46391 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
mpp  Micromonas pusilla
Pathway
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mpp01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:mpp01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpp01230]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:mpp00710]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mpp00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 477 aa AA seqDB search
MSTITVDNINAKVREMQYAVRGAIVQRAGEIEDGLKADPSKYPFDKVVYCNIGNPQSLGQ
KPISFFRQVLALCDYPDLLLAPGIEKTFPEDVRKIAKDILDNTTGGTGAYSHSQGVAFMR
KMVAAGISDRDGHPCDVNDLWLTDGASVGCHYLMKTLITDERDAVLTPIPQYPLYSACLA
LYGGTLLPYYLREEQGWALDVAELKSQTDKARGEGKNVRALVIINPGNPTGAALGLDNQK
EIVQFCKDEGILLVADEVYQENVYAEGKSFTSFKKVVRDLGVDIPIVSLNSTSKGFFGEC
GRRGGYMEVCGIDKGVAEQLYKLSSVGLCSNLAGQIVMALVMKPPKEGDASYPLYKQEKD
DILSSLKRRAVTLVNGLNALEGVSCQEAEGAMYAFPKIDLPAKFLKEAEGSGMAPDALYC
MRLLEATGIVVVPGSGFGQVEGTWHFRTTFLPAEADIEGVVQKMTKFHGDFMDAYRN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgatcaccgtcgataacatcaacgccaaggtgcgcgagatgcaatacgccgtg
agaggcgcgatcgtgcagcgcgcgggcgagatcgaggacgggctgaaggcggacccgtcg
aagtatccgttcgataaggtggtgtactgcaacatcggaaacccgcagtcgctcgggcag
aagcccatctcgttctttcgccaggtcctcgcgttgtgcgattacccggacctcctcctc
gcgcccgggatcgagaagacgttcccggaggacgtgagaaagatcgcgaaggatatcctg
gacaacaccacgggcggcaccggggcgtactcccactcccagggcgtggcgttcatgcgt
aagatggtcgcggctgggatctcggatcgcgacgggcacccgtgcgacgtcaacgatctg
tggctcaccgacggcgcgtccgtgggctgccactacctcatgaagacgctcatcacggac
gagcgcgacgcggtgttgacgccgatcccgcagtaccctctgtattccgcgtgtctcgcg
ctgtacggcgggacgttgctgccgtattacctccgcgaggagcagggttgggcgctcgac
gtggcggagttgaaatcgcagacggacaaggcgagaggcgaggggaagaacgtccgcgcg
ctcgtgatcatcaaccccgggaacccgaccggcgcggcgctcggtttagataaccagaag
gagatcgtgcagttttgcaaggacgagggcatcctcctcgtcgcggacgaggtgtaccaa
gagaacgtgtacgccgagggtaagagcttcacgtctttcaaaaaagtcgtccgcgacttg
ggcgtcgacatcccgatcgtttccctgaacagcacgtcgaaagggttcttcggcgagtgc
ggccgccgcggcgggtacatggaagtgtgcgggatcgacaagggcgtcgcggagcagctg
tataagctgtcgtcggtcggtttgtgctcgaacctcgccgggcaaatcgtgatggcgctc
gtgatgaagcccccgaaggaaggcgacgcgtcgtacccgctgtacaagcaagagaaggac
gacatcttgtcctcgttgaagcgccgcgcggtcacgctcgtgaacggcctgaacgcgctc
gagggcgtgtcgtgccaggaagccgagggcgcgatgtacgcgttcccgaagattgacctt
cccgcgaagtttttaaaagaagccgagggcagcggcatggcgccggacgcgttgtattgc
atgcgtctgctggaagcgaccgggatcgtcgtcgtcccgggcagcgggttcggccaggta
gaggggacgtggcacttcaggacgacgttccttcccgcggaggcggacatcgagggcgtc
gtgcagaagatgaccaagttccacggcgatttcatggacgcgtacaggaattaa

DBGET integrated database retrieval system