KEGG   Micromonas pusilla: MICPUCDRAFT_48400Help
Entry
MICPUCDRAFT_48400 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
mpp  Micromonas pusilla
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MICPUCDRAFT_48400
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MICPUCDRAFT_48400
Enzymes [BR:mpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MICPUCDRAFT_48400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1073 aa AA seqDB search
MARSGGAAALALLALALLLLLRAPSPSPVSFDDDLGIPPPGVGWRHRIGDAPEDGADAKR
PRPTPMRGTVDDGARHGAPLGGLGSGSIGRSYLGDFSRWHLKVGSHTHRVAAHTFAACRV
NGVATVLSASPAHASLEGVPSSEDDDDSPPPRTRRRRTLPEDGIGGNYTALYPRAWYEYA
PDALHPDARVVVSQVQFSPVLPGDYRASAVPTGVLRFVARNDGRATANVSIMLSFESVLA
SADVAPLDVSGPRDAWRVASEPTTHETFFSSRESRREGRRRRRIIVGGAHAHTVGVTDGT
FTPSADHHGGVAIAAEGGDGVEVSVLREYDTLDGDAVAAAWDAFERNGGFAEDEDEEDEA
AAEEDAASAASASAAKVASPGAAAAVSAKFSLKPGERRSIAFAIAWDLPVATFPRGPAFL
KRYAWRRRRRGGGAADVAMSALRRAASWERRVRAWQAPYVDSAANADSKSPVRRPGWFVT
ALFNELYYLVDGGTLWGRPLSVGGLDGDEFDDDEDDEVEDALDGDSADDAEVRLLPIRPR
SRGERRSLRRLGLLGGEDGDGGDARDVIGNGGAWGGTLGRFGSASDVDRATYNALDEYFY
GSWPLATLWPGLDLAVIGDLAHAVDAADDTERRVLWRALGSAKKSAGGTGATTTTIASQT
KRRKIRGVAPRDLGTSRDAPLTSAPNALSDVDSNALLDLAPKLMLLVARAHALRGGFRGP
EAMASFGGGLERDALRRVFEPAYRALATQLRARDLNGDGLPEHGDADAPTLSGYDRWVVS
GNASSYGGGLWLAALRAGAGIARDLDETDARTSLEETLRIAAKSFDEALWRGGGGGGGGG
VRKSQSRSRRGTHALEGYYAADASGTDAGDVVLAGQVMGEWALGMIRAPGVLDPRKVRAA
LSTTYERNVKAFGRARGGSGSGSDDEPSTYVPSGAVNGARVDDATDAAALGVGAGDGIPA
QARESRVGQSYALASHLILAGFSDEGWDVARGAYRVTYEDGFAFRTPEIFDAERRFRGAI
SGRAGAVWAIERSLATAAARARRSEEARAAREKGDDATPAASRDARVEDKDEL
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgctcagggggagccgccgcgctggcgctcctcgcgctggcgctgctcctcctc
ctccgcgcgccatcgccatcacccgtcagcttcgacgatgacctcgggatcccacccccc
ggcgtggggtggcgccatcgcatcggcgacgcccccgaggacggcgccgatgcgaagaga
ccgcgtccgacgccgatgcgaggcacggtcgacgacggcgcgcgacacggcgccccgctc
ggcggcctcgggtccgggtcgatcggaaggtcctacctcggcgacttctcgcggtggcac
cttaaagtcgggtcgcacacgcatcgcgtcgccgcgcacacgttcgccgcgtgccgggtg
aacggcgtcgcgaccgtgctgtccgcgtcgcccgcgcacgcgtccctggagggcgtcccg
tcttccgaggacgacgacgattcgcctccgccgcgaacgcgacgtcgacggacgctcccg
gaggacggcatcggcgggaactacaccgcgctgtacccgcgcgcgtggtacgagtacgcc
cccgatgcgctgcatcccgacgcgcgcgtcgtcgtgtcgcaggtgcaattctccccggtg
ctcccgggggactaccgcgcgtccgccgtccccacgggcgtgcttcgcttcgtcgcgcgg
aacgacgggcgcgccaccgcgaacgtctcgatcatgctgagcttcgagagcgttctggcg
tccgcagacgtcgcgccgttggacgtgagcggaccgagggacgcgtggagggtcgcgtcc
gagccgacgacgcacgagacgttcttctcctcgcgcgaaagccggcgggaggggcggcga
aggcggcggatcatcgtcggcggcgcgcacgcgcacacggtcggcgtcacggacgggacg
ttcacgccgagcgcggaccaccacggcggcgtcgcgatcgcggcggaggggggcgacggc
gtcgaggtcagcgtgttgcgcgagtacgacacgctggacggcgacgcggtggccgcggcg
tgggacgcgttcgagagaaacggggggttcgcggaggatgaggacgaggaggatgaggcg
gcggctgaggaggatgcggcgtcggcggcgtcggcgtcggcggcaaaagtcgcttccccg
ggcgccgcggccgcggtgtcggcgaagttctcgctgaagcccggagagcgacggtcgatc
gcgttcgcgatcgcgtgggatctccccgtggcgacgttcccgcgcggcccggcgtttttg
aagcggtacgcgtggaggcggcgtcgcagaggcggcggcgcggcggacgtcgcgatgagc
gcgctgagacgcgcggcgtcgtgggagcggcgcgtgcgcgcgtggcaggcgccgtacgtg
gactccgcggcgaacgcggactccaaaagccccgttcgacgccccgggtggttcgtcacc
gcgttgttcaacgagctgtactacctcgtcgacggcgggacgctgtgggggcggccgctc
tccgtcggcggcttggacggggacgagttcgacgacgacgaggacgacgaggtcgaggac
gcgctcgatggcgactccgccgacgacgcggaggtgagactgcttcccatacgaccccgt
tcgcgtggtgaacgccgttccttaaggcgcctcggtcttctcggcggcgaggacggcgac
ggcggcgacgcgcgcgacgtcatcggcaacggcggcgcgtggggcggcaccctggggagg
ttcgggagcgcgtccgacgtcgaccgcgcgacgtacaacgcgttggacgaatacttttac
gggtcgtggccgctcgcgacgctgtggccggggttggacctcgccgtgatcggggacttg
gcgcacgcggtggacgccgcggacgacacggagaggcgcgtcctgtggcgcgcgctgggg
tcagcgaagaagagcgcggggggcaccggggcgacgacgacgacgattgcgagccagacg
aagcgacggaagatccggggcgtcgcgccgagggacctggggacgtcgcgcgacgcgccg
ttgacgtcggcgccgaacgcgctctccgacgtcgactcgaacgcgctcttggacctcgcg
ccgaagctgatgcttctcgtcgcgcgcgcgcacgcgctcagaggcgggttcaggggcccc
gaggcgatggcgtcgttcggcgggggtctcgagcgcgacgcgttgcgacgggtgttcgag
cccgcgtaccgggcgctcgcgacgcaactccgcgcgcgcgacttgaacggcgacgggttg
cccgagcacggcgacgcggacgcgccgacgctgagcgggtacgatcggtgggtcgtctcg
gggaacgcgtcgtcgtacggcggcgggctgtggctcgcggcgttgcgcgcgggcgcgggc
atcgcgcgggatttagacgagacggacgcgcggacgagcctggaagagacgctgcgcatc
gcggcgaaatcgttcgacgaagcgctgtggcgcggcggcggcggcggcggcggcggcggc
gttcggaagtcccagtcccggtcccgccgggggacccacgcgttggaggggtactacgcc
gcggacgcgagcggcacagacgcgggcgacgtcgtcctcgccgggcaggtcatgggcgag
tgggcgctggggatgatccgcgccccgggggtgttggatccgagaaaggttcgcgcggcg
ctctcgacgacgtacgagcgaaacgtgaaagcgttcggtcgcgcccgcggcggttccggt
tccggttccgacgacgagccgtcgacctacgtgccgtcgggcgcggtgaacggcgcgcgc
gtcgacgacgcgaccgacgccgccgccctcggcgtcggcgcgggggatggcatcccggcg
caggcgagggagtctcgagtcggtcagtcgtacgcgctcgcgtcgcacctcatcctcgcg
gggttctcggacgaggggtgggacgtcgcgcgcggggcgtacagggtgacgtacgaggac
gggttcgcgttccgcacgccggagatattcgacgcggagaggcggttccgcggcgcgatc
tccggtcgagccggcgcggtgtgggctatcgagcggtcgttggcgacggcggcggcgcgc
gcgcggcgttcggaggaggcgagggcggcgagagagaagggagacgacgcgacgcccgcg
gcatcgcgcgacgcgcgggtcgaggacaaggacgagctttga

DBGET integrated database retrieval system