KEGG   Micromonas pusilla: MICPUCDRAFT_4850Help
Entry
MICPUCDRAFT_4850  CDS       T02696                                 

Definition
histone deacetylase
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
mpp  Micromonas pusilla
Brite
Enzymes [BR:mpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     MICPUCDRAFT_4850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 214 aa AA seqDB search
RALIELVKNARSRGGAIVHTGAGISTSTGIPDFRGPNGIWTAQRNGGAIPKASCAFFLAR
PSATHMALVALREAGYVRFLVSCNVDCLHLRSGYPRECLAELHGNCFAERCERCEREYVR
DFEMPSVGFKRTGRACGEAGCGGRLRDQVLDWEDALPPKELKLAEKHSRDAPLALVLGSS
LQITPSCDLPLKTVRAGGDLVIVNLQATPKDKKA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
cgcgcgctgatcgagctcgtgaagaacgcgcgatccaggggtggcgcgatcgtgcacacg
ggcgcggggatatccacctcgacgggcatcccagacttccgaggaccgaacgggatatgg
accgcgcagaggaacggcggcgcgatcccgaaggcgtcgtgcgccttcttcctcgcgcgc
ccgagcgcgacgcacatggcgctcgtggcgctgcgcgaggcggggtacgtccggtttctc
gtctcgtgcaacgtcgactgcttgcacctgcggagcgggtaccctcgcgagtgcctcgcg
gagctgcacgggaactgcttcgcggagcggtgcgagaggtgcgagagggagtacgtgcgc
gacttcgagatgccgagcgtggggttcaagcgcacggggcgcgcgtgcggcgaggcggga
tgcggcggccgcctcagagaccaggtgttggattgggaagacgcgcttccgcctaaagag
ctgaagctcgcggagaaacactccagagacgcgccgctcgcgctcgtgctcgggagctcg
ctgcagatcacgccgtcgtgcgacttgccgctgaagacggtgcgggcggggggcgacctc
gtcatcgtgaacttgcaggcgacgccgaaagacaagaaagcc

DBGET integrated database retrieval system