KEGG   Micromonas pusilla: MICPUCDRAFT_48821Help
Entry
MICPUCDRAFT_48821 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mpp  Micromonas pusilla
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mpp04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 501 aa AA seqDB search
MRIVPRSLASIALVAILASIALVAPIPADALYGEASSAVIVLSGEKEFNARVVDADDEYW
LVEFYAPWCGHCQKLAPEYDAAAKALSGHDATRKAKLGAVDCDEESNKALCASAGVKGFP
TIKGYNKLAGSEDRETSESYDGSRDKDGIVNFVKGRLSGGGGGGGGGGGGGESKLAPKLT
YDKAFPFLHGGDASIPKVILLTTGAGPAGKNTPGWFTSVAVKYKKGKKYDVMFAHNAEEE
PAGISRNFKVSEFPAVVFARSDGAGGGRYKVLPAATLNTFMKVSDNIKTVVNFVDDAKAR
SLESISTSDDFAEMPKFPEPRKPRKQADVKYAALTEDNVDVDCFGGNAVICVIAVVDAPA
GDDFNENAAMAEIAKKYRNDPLSFVWVDAESNADFIHPFGLTPEDTPRLVAVKSGKRNRF
TIYDPEGALDVKGASDFLDKILGGDARFTGMQALPTFEPSYLKTTDEEDEEEAAEEEVEE
VVEEGVGEEVEVVEEVEEEEE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgtcccgcgctccctcgcgtccatcgcgctcgtcgcgatcctcgcgtccatc
gcgctcgtcgcgccgatccccgcggacgcgctgtacggcgaggcgtcctccgcggtgatc
gtcctctcgggcgagaaagaattcaacgcgcgcgtcgtcgacgcggacgacgagtactgg
ctcgtggagttctacgcgccgtggtgcgggcactgccagaagctcgcgccggagtacgac
gccgcggccaaggcgctgagcgggcacgacgcgacgcgcaaggcgaagctcggcgcggtc
gactgcgacgaggagtcgaataaggcgctgtgcgcctccgccggcgtgaagggattcccg
acgatcaaagggtacaacaagctcgcggggtcggaggacagggagacgtcggagagctac
gacggctccagggataaggacgggatcgtgaacttcgtgaagggtcgtctgagcggcggc
ggcggcggcggcggcggcggcggcggcggcggcgagtccaagttggcgcctaagctgacg
tacgacaaggcgttcccctttctccacggcggcgacgcgtcgatacccaaggtgatcctc
ctgaccaccggcgcgggtcccgcggggaagaacacccccgggtggttcaccagcgtcgcg
gtgaagtataagaaggggaagaagtacgacgtgatgttcgcacacaacgcggaggaggag
cccgccgggatctcgaggaattttaaagtttccgagttccccgcggtggtcttcgcgcgg
tcggacggcgccggcggcgggcgctacaaggtcctccccgcggcgacgctgaacacgttc
atgaaggtgtcggacaacatcaagaccgtcgtgaacttcgtggacgacgcgaaggcgcgg
tcgctggagtcgatatcgacgtccgatgatttcgcggagatgccgaaattcccagagccg
cgcaaaccgaggaagcaggcggacgtgaagtacgcggcgctgaccgaggacaacgtcgac
gtcgactgcttcggcgggaacgcggtcatctgcgtcatcgcggtcgtggacgcccccgcc
ggggacgatttcaacgagaacgccgcgatggcggagatcgctaaaaaataccgcaacgac
ccgctctccttcgtatgggtcgacgccgagtcgaacgcggactttatccacccattcggg
ctcaccccggaggacaccccgaggctcgtcgcggtcaagagcgggaagcgaaaccggttc
acgatctacgaccccgagggcgcgctcgacgtgaagggcgcgagcgactttttggacaag
attctcggcggcgacgcgaggttcaccgggatgcaggcgctcccgacgttcgagccgtcg
tacttgaagacgacggacgaggaggacgaggaggaggcggcggaggaggaggtggaggag
gtggtggaggagggcgtcggcgaggaggtcgaggtcgtggaggaggtcgaggaggaggag
gagtga

DBGET integrated database retrieval system