KEGG   Micromonas pusilla: MICPUCDRAFT_49461Help
Entry
MICPUCDRAFT_49461 CDS       T02696                                 

Gene name
SBEIIA
Definition
glycoside hydrolase family 13 protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mpp  Micromonas pusilla
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MICPUCDRAFT_49461 (SBEIIA)
Enzymes [BR:mpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MICPUCDRAFT_49461 (SBEIIA)
Exosome [BR:mpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MICPUCDRAFT_49461 (SBEIIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 927 aa AA seqDB search
MSSVGAVSSHAVVALAGIKSSREKYGSGARIARRTVAFTPASFTKRARKAKFSLRASDVD
DELAAVAAAVEALRLENERLKADLDPNSVTSKGASPPPPPPPAPPLPPTPMQQAESDTIP
SEPPTPVPPPSPPSNPESSEPHVPPVEDVKPEPSFAAAAGGSSHAPPGVSASSSGSGSAG
PSAKDFVPVTPTRENTKPIYGANVLPMNEPPASERFANFEYPPITTDGMGVCMLDGTLNQ
FRDHLGYRWSKYCALRDAIDQNEGGIELFSRGYEKMGFNRSPEGITYREWAPNATAACLF
GDFNQWSTGADGVWMTKNDFGVFEVFMPNNADGSPAISHGTRVKIHLEIEGQEPVDKIPA
WIKFAVQAPDEIPFNGIYYDPPDSEVYKFQYARPQSPPELRIYEAHVGMSSTEPKINSYV
EFADDVIPRIAQLGYNAVQLMAVQEHAYYASFGYHVTNFFAVSSRCGTPDELKYLIDTAH
SYGIVVLMDIVHSHASSNSLDGINMFDGSNGQYFHDGPQGYHWMWDSRCFNYGNWEVIRF
LLSNLRYWMEEFKFDGFRFDGVTSMMYSHHGLQMAFTGDYNEYFGMATDVDAMVYLMLAN
DMLHTLYDGHVLTAAEDVSGMPTLARPVSEGGVGFDYRLQMAIADKWVEVLSEWGMDENW
DMGNLVHTLENRRWGEKAIAYAESHDQALVGDKTTAFWLMDKEMYDHMSTLTPDHPVVTR
GIAIHKMIRQLTMCLGGEGYLNFMGNEFGHPEWIDFPRGDRVEASTGEFVPGNGNSYHLC
RRRFDLADMDHLRYKYLNAFDAAMNNIAGRFKYLCSDHQYTSLKDDGDKMIVVERGDLVF
IFNFHPNQSYSDYRIGTKQGGMYKLVLSSDNPEFGGYSNLWTYSAPDIKADEWEFNGRPA
SMLIYAPSRSVSVYAPADLAIEKMEYA
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgttggcgcggtttcgagccacgcggtggtggcacttgcggggatcaagtcc
tcccgggagaaatatggttccggcgctcgcatcgcgagacgcacggtcgcgttcaccccc
gctagcttcacgaagcgcgctcgcaaggccaaattctcgctacgcgcatcggatgtcgac
gatgagttagcggctgtcgccgctgctgtggaggctctccgtttggagaatgaacgtctg
aaggcggaccttgacccaaattcagtcacgagcaagggcgcttcccctccgccaccacct
ccccccgcccctcctttgccgccaacccctatgcagcaggctgagtctgacactatcccc
tcggaaccaccaacaccggtgcctccgccttccccgccctcaaatcctgaatcttcggag
ccacatgtgcctccagttgaagatgtgaaacccgagccgtccttcgcagcagcagccggt
ggatcttcgcacgccccccctggcgtatctgccagcagcagtggttctggaagtgcaggc
ccgtcagcgaaggacttcgttcctgtcaccccgactcgcgaaaatacaaaacctatttat
ggtgccaatgttcttcccatgaacgaacctcctgcttcagagagattcgcgaactttgag
tatccccctatcaccactgatggcatgggcgtctgcatgttggatggcactctcaaccaa
ttcagggaccatcttgggtaccgttggtcaaagtattgcgcacttcgtgatgccattgat
caaaacgagggcggtattgaactgttcagtcgaggttacgagaaaatgggcttcaatcgc
tctccagaaggaatcacctatcgagaatgggcccctaatgcgacagccgcgtgcctcttc
ggtgacttcaaccagtggtccacgggcgctgatggtgtgtggatgacgaagaacgacttc
ggcgtcttcgaggtattcatgcccaacaatgccgatggttcaccagcaatatcacacgga
acacgcgttaaaatacatctcgaaatagagggacaggaacctgtggacaagattcccgct
tggataaagtttgcagtccaggctcctgatgaaattccgttcaacggtatttactacgac
ccgccagactctgaggtgtacaagtttcagtacgcacgtccacaaagtccgccagagctg
cgcatctacgaggcacacgtcggcatgtcttcaactgagccaaaaattaatagttatgtt
gagtttgctgacgatgtcattccgcgcatcgcccagcttgggtacaacgcggtgcagctg
atggctgtgcaggaacatgcatattatgcatctttcggctaccatgtcacaaattttttt
gccgtttcttcacgctgtggcacccccgatgaactcaagtatcttatcgacacagcgcac
agctacggtatagtagtactgatggatattgtacactcgcacgcctcctccaactctctt
gacggtataaacatgtttgatggatctaacggacagtacttccacgacggtcctcagggt
tatcactggatgtgggatagccgctgcttcaactacggaaactgggaagttatacgtttc
cttctttcaaaccttcgatactggatggaggaattcaagttcgacgggttccgtttcgat
ggtgttacctcgatgatgtactcccaccacggacttcagatggcgtttacaggtgactat
aacgaatactttggaatggcgactgatgttgatgccatggtctacctcatgcttgccaac
gacatgctgcacacactttacgacggccatgtgttgacggctgctgaagatgtgagtggt
atgccaacactggcgcggcctgtatctgaaggtggtgttggctttgactaccgcttgcag
atggcgattgcggacaaatgggttgaggtactctcggaatggggcatggatgaaaattgg
gacatgggtaaccttgtacacacgctagagaatcggcgctggggcgagaaggcgatagca
tatgccgaatcacacgaccaggccctggttggcgataagacaactgccttttggttgatg
gacaaagagatgtacgatcacatgtctacgctgacgcctgaccaccccgttgtaacaaga
ggaatcgcaattcacaaaatgatccgccagctcaccatgtgtctaggaggggagggttac
ttgaactttatgggaaatgagttcggtcacccagaatggattgatttccctcgtggtgat
cgcgttgaggcatctacgggcgagtttgtgcccggtaatggcaactcctaccatctatgc
cgcagaaggtttgaccttgcggacatggatcacctacgatacaagtatttgaatgcattc
gatgccgctatgaacaacatcgctggtcggttcaagtatctttgttcagatcatcaatat
acctctctcaaggacgacggtgacaagatgatcgtggtggagcgcggagatcttgtcttt
attttcaactttcatccgaaccagtcgtatagcgactaccgcatagggacaaaacaggga
ggcatgtacaaactggttttatcttcagacaaccccgagtttggcggctactctaatctc
tggacttacagtgctccagatatcaaggcagatgagtgggagtttaacgggcgccccgca
tctatgttaatatatgccccaagtcgcagtgtctctgtctatgcaccggctgaccttgcg
atcgagaagatggagtatgcctaa

DBGET integrated database retrieval system