KEGG   Micromonas pusilla: MICPUCDRAFT_49773Help
Entry
MICPUCDRAFT_49773 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mpp  Micromonas pusilla
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MICPUCDRAFT_49773
Enzymes [BR:mpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MICPUCDRAFT_49773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 442 aa AA seqDB search
MSDFPRPCQHCNEIVLNRTAYYRNHKKGRCLVIPGDPREAPARSEMKRAKKTRDDDNGPD
DETTPPPPPAVVVFGSANVDLAMRAPVLPAPGVTVLAPSYALAPGGKGANAACACAVTGR
GRNRIAMTSAFVDVFDVVVKFVGAVGDDAFGAMLKDAFADAGVDATHLATRTASAARTGC
ASVIVDARGENQICVGAGANATVNAKEQLGGVGAGKMLRPGDVFLTQLEVPAREVWDAIA
IAKEAGLTVVLNAAPAAAVPAEVLKQVDFLVVNEHEAARVEAFAVAPGCAHPAALRGRLD
PPIEAAWQIAREHRVVVVVTLGANGAAVALPVVVSSKLGFIAGAEVRRFGVAPLRANESV
IDTAGAGDAFVGAFAASLARGDDVDTCMTRASYAGAAACTAKGARGGVPTGAEIDARTRE
EPRMAPPTRELFDARGMPVPLV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactttcccagaccctgccagcactgcaacgagatcgtcttgaaccggacggcg
tactacagaaaccacaagaaggggcggtgcctcgtcatcccgggggacccgcgagaggcg
cccgcgcgaagcgagatgaaacgcgcgaagaagacgcgcgatgatgataacggccctgat
gatgagacgacgccccctcctcctcccgccgtcgtcgtcttcggctccgcgaacgtcgac
ctcgcgatgcgcgcgccggtcctccccgcgccgggcgtgaccgtcctcgcgccgtcgtac
gcgctcgcgccgggagggaagggcgcgaacgcggcgtgcgcgtgcgcggtgacggggcgc
gggcggaaccgcatcgcgatgacgagcgcgttcgtcgacgtcttcgacgtcgtcgtgaag
ttcgtcggcgcggtcggcgacgacgccttcggcgcgatgctcaaggacgcgttcgcggac
gcgggcgtggacgcgacgcacctcgcgacgcgcactgcgagcgcggcgcgcacgggatgc
gcgtccgtgatcgtggacgcgcgaggagagaaccagatctgcgtcggcgcgggcgccaac
gcgacggtgaacgcgaaggagcaactgggcggcgtgggtgctgggaaaatgctgcgtccc
ggggacgtcttcttgacgcagctcgaggttcccgcgcgcgaggtgtgggacgcgatcgcg
atcgcgaaggaggcgggcttgacggtggttctgaacgccgcgccggctgcggcggtgccg
gcggaggttctgaagcaggtcgacttcctggtcgtcaacgagcacgaggcggcgcgcgtg
gaggcgttcgccgtcgcgcccggatgcgcgcacccggcggcgctgcgcggacgtttggat
ccgccgatcgaggcggcgtggcagatcgcgcgggagcaccgcgtcgtcgtggtcgtcacc
ctgggcgcgaacggcgccgcggtggcgcttccggtcgtcgtgagctccaaattagggttt
atcgcgggcgcggaggtgcgtcgattcggcgtcgcgccgctgcgagcgaacgaatcggtg
atcgacaccgccggcgcgggcgacgcgttcgtcggcgcgttcgccgcgtctctcgcgcgc
ggcgacgacgtcgatacgtgcatgacgcgcgcgtcgtacgcgggcgcggcggcgtgcacg
gcgaagggcgcgcgcgggggcgttccgaccggggcggagatcgacgcgcggacgagggaa
gagccgcgaatggcgccgccgacgcgcgagctgttcgacgcgcgcgggatgcctgttcct
ttagtctag

DBGET integrated database retrieval system