KEGG   Micromonas pusilla: MICPUCDRAFT_55430Help
Entry
MICPUCDRAFT_55430 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mpp  Micromonas pusilla
Brite
Enzymes [BR:mpp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MICPUCDRAFT_55430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 674 aa AA seqDB search
MTPELFAFVSVVFFFASIFALVTSNATKLVRTKVSQALAPQPHDVNVEEDDVKLRIAVFF
GTQTGTSERFAREVEAELNQRYGTAVCVRTADLENVTPDLADESFCAKEEPLAIFLQSTY
GDGEPTDTSTEFVHQLRDLAGSGKMSKHLQKLTFSVFGLGNSSYEHFNAAAKLLDKSLEQ
LGATRLVDIYLGDDDGSLEDDFQSWKECLWAEIEGRYCISAANSCGNDLTSYVVISASMD
DAEAVHQNLEASLTQNPAEGRTSSTAPYSAQVCRAFELHSNASDRSCVHVDFNICGTGIC
YQHGDHLGVFAENSLPVVQRGASCLNYQLDYVFTLTIPSGAPASLSTPFPTPCTLKAALT
KYADLLSPPRKTALAALASVSSNPAQKARLYHLASAAGKQEYNAYIVDPGRSLLEVLEAF
PSAVPPLGLFFGFVSARLAPRFYSISCSPLDNPGIVSASVAVVREERPTGRLHEGVASSF
LARYLPEKGERNLPAVINSHRVPLFVHPSNFKLPRNASTPVVMIGPGTGFAPFRGFLQER
AALRRCGKLLGPAYLFFGCRSEHHDFIYREEMEDALANETISELHVAFSREFSNRKVYVQ
DKLMEFSSKLNSVMKDDQGCAGSIYICGNAKGMARDVNRALHSILIREGGYAGYEAEGII
AHLSEAGRYQKDVW
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctgagctgtttgcgtttgtttcagttgtttttttctttgcatcgatattcgca
ttggtcacgagcaatgcgactaaattggttcggaccaaggtttcccaggcgctggccccg
cagccccacgacgtgaatgtagaggaggacgacgtgaagctccggatagccgtgtttttc
ggcacgcaaacaggcacatcggaaaggtttgcgcgtgaagttgaggccgagttaaaccaa
cgatacggaacagctgtctgtgtgcgcacggctgatttggagaacgttacgccggacctg
gctgacgagtcattttgtgcgaaggaagagccacttgctatctttcttcagtccacttat
ggagatggagagccgactgacacttcgacggaattcgtccaccaactccgggacctggcc
ggatcgggaaagatgtctaagcatcttcaaaagctgacgttttccgtgtttgggcttgga
aatagctcatatgaacattttaatgctgctgcgaaactactagacaaatctcttgagcaa
ttaggtgccacacgcctcgtggatatttacttgggtgacgatgatggttctctcgaggac
gactttcagagctggaaggagtgtttatgggccgaaatagaaggcaggtattgtatcagc
gctgcaaatagctgcggaaacgatttgacttcatatgttgttatctctgcctcgatggat
gatgcagaagctgttcatcaaaacttagaagcctcactgacacagaatccagctgagggt
agaacttcttctactgctccatactccgcccaagtctgtcgtgccttcgaactccattcg
aatgcgtctgaccgtagttgcgttcatgttgattttaacatttgtggaactggtatatgc
tatcagcatggcgatcatcttggcgtctttgcggaaaattctttacctgtagtgcaaaga
ggtgcttcctgtctaaactatcaacttgactacgtgttcacactaacgattccatcagga
gctcctgcttccctttcgactccatttcctaccccttgcactctgaaggctgcactcaca
aagtatgcagatctgctgtctcccccacgcaagactgcccttgcagcacttgcctccgtt
tctagtaatcctgctcagaaggcccgtctgtaccatttggcatcagcggctggcaagcaa
gagtacaacgcgtacattgtcgatcctggacgctccttgctagaggttcttgaagccttt
ccttcagctgttcctcctttgggtttattttttgggtttgtcagtgctcgacttgcacca
cgattctactcgatctcatgcagtcctttagataatcctggtattgtatctgcttcggtc
gctgtagtcagagaggaacgacccactgggcgcctgcatgaaggcgttgcttcgagcttt
ttggcgcgttacctgccagaaaaaggtgaaagaaatctccctgcagtaataaactcacac
cgcgttccattatttgtacaccctagtaacttcaagcttccacggaatgcatccacgcca
gttgtgatgattgggccaggaacgggattcgctccattcagggggtttctgcaggagcga
gctgccttacgaagatgtggcaagctcctcggacctgcatatcttttctttggctgcaga
agtgagcaccatgactttatctatcgggaggagatggaagatgctttggccaatgaaacc
atcagtgaattgcacgtagcttttagtcgcgagttctctaatcgaaaagtgtatgtgcag
gataaacttatggagtttagcagcaagctaaatagtgtcatgaaggatgatcaaggctgt
gctggttcgatttacatttgtggaaatgcgaagggcatggcccgtgatgtgaaccgcgca
ctccacagcatcttgataagggaagggggatacgcaggatacgaggcagaaggcatcata
gcgcatctctctgaggcaggaaggtaccagaaggatgtatggtga

DBGET integrated database retrieval system