KEGG   Micromonas pusilla: MICPUCDRAFT_55672Help
Entry
MICPUCDRAFT_55672 CDS       T02696                                 

Definition
phospholipase
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mpp  Micromonas pusilla
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MICPUCDRAFT_55672
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MICPUCDRAFT_55672
Enzymes [BR:mpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     MICPUCDRAFT_55672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 590 aa AA seqDB search
MGESSFSFGGSCRNRPSFLKLYFYVQGLSCSGRLPQAFSPECDVAAIVFSGFFDETKRAI
SKESLKNFFRDSQKEKAPKFNRDAYDIEEALRDFVLTGDNLIIGKCVVDVSSMNEPLSHY
FINSSHNTYLSGDQLFSRSLTFAIKRALLHGCRVIELDCYDGGREGPVVMHGITATQSIT
FRNALKTIKQDAHTTSEYPVIITMENHCSKLKRVELAKILLEELGDKLFIPLSLHLNQWP
SPSELKGRILIRDKIGTKQVLREASGSPYLVRTQPIPICRRFVDNAEDIARFEISDDVTN
REEPCEAFSYFNFKFMRSTNSYEPPTPSSEKVKQQVCNEMFKSLISIENIKIKVIKEALE
IERVISCSWDELTLNNRKWALDKATMLDFTGRHLLRCYPNRRRVTSQNFDPSLAWSMGAQ
MVALNFQTNDLAMWLNRGKFVANGGCGFVRKPEYLIDPSVPAPSEPTRVLTITIIAGSGW
EILEHRTHASAPQTYVRITIAGNVKDFKSCTSSVSTSHSRTSDAQPFFNETFEFHLIEPD
LALVLFTVHDKSVKTPEMFLAQHCSPVNLLRSGTRISPLYSAEGTCLSRE
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggggagtcgtcattttccttcggtggatcctgtagaaatcggccaagttttctaaaa
ctttatttttatgttcagggcttaagttgcagtggccgacttcctcaggcttttagtccc
gaatgcgatgttgccgcgattgtgttcagtggattttttgatgagacgaaaagggccata
agcaaagaatccctcaagaacttttttagagattcacaaaaggaaaaagctccaaaattc
aacagggatgcctatgacattgaagaagctctaagggactttgttctcactggtgacaac
ctaatcatcggcaagtgcgttgtggacgtgtcttcaatgaatgaaccattatcgcattac
ttcatcaatagttctcacaatacatatttatccggtgatcagcttttttcaaggtctttg
acttttgcaataaagcgagcacttttacatggttgtcgtgtcatcgagcttgattgctat
gacggaggaagagaaggaccggttgtcatgcatggcatcaccgcaacgcaatcaataacg
tttcgcaatgcattaaaaactataaagcaggatgcacacacaacctctgagtatccagtc
atcattacaatggagaatcactgctctaaattaaaacgagttgagttggctaagattttg
cttgaggagctcggagacaagctgttcataccgctttcattacatttgaaccaatggcct
tcaccttcagaactaaaaggccgcatactgatacgagataaaatcgggactaagcaggta
cttcgtgaagcgtcaggctcgccataccttgtcaggacgcaacccattccaatttgcagg
cgtttcgtcgacaatgctgaggatatcgcgaggtttgaaatttcagatgatgtcactaac
cgggaagaaccttgcgaagcattttcttattttaattttaagtttatgaggtcgacaaat
tcttatgagccaccaacaccttcatcagaaaaggtaaagcagcaagtatgcaatgaaatg
ttcaaatcactaatatccatcgaaaatattaaaatcaaggtaatcaaagaagctttagaa
attgagcgcgtgatctcgtgttcatgggacgagttgacgctaaataatcgtaaatgggcg
ttagataaagccaccatgcttgactttaccgggagacaccttctaagatgttacccgaat
aggcgtcgcgtaacttcacagaactttgatccctctttagcatggtccatgggggctcag
atggttgcattaaactttcagacaaatgacctagccatgtggttgaatcgaggaaagttt
gtcgcaaatggaggttgtggtttcgttcgcaagccagaatatcttattgatcctagcgtt
ccagcaccgtcagagcctacccgtgtactcactattacaattattgctggcagtggctgg
gaaattctcgagcacagaactcatgcaagtgctcctcaaacttatgtccgcattactatt
gctgggaacgtgaaagacttcaagtcatgcacaagctcggtttccactagccacagtcgc
acgtcagatgcacaaccatttttcaatgaaactttcgaatttcatctgatagaaccagat
ctggctctggtattgttcacagttcatgataagtcagtcaaaacaccagaaatgtttcta
gcacagcactgtagccctgttaacttgcttcgttcaggcacgagaatttcgcctctttac
tctgcagaaggcacctgcctaagtagggaataa

DBGET integrated database retrieval system