KEGG   Micromonas pusilla: MICPUCDRAFT_55889Help
Entry
MICPUCDRAFT_55889 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mpp  Micromonas pusilla
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MICPUCDRAFT_55889
Enzymes [BR:mpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MICPUCDRAFT_55889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 883 aa AA seqDB search
MTARVSTAATRLRTASSLFPARRPPFRILLLLLLLLARARRAVAEANHGAFVHGVASGDP
TSDAIVIWTRVTPTGRNYPGGVDPPDDITFDVRWTVATAPPRGPADDAVDAASAERDDDG
TWGSSETAVGVDADAAAWGFPRGSIVKTGTIAGVSNETDWTVKKDVSGLSHSTRYYYAFN
IERDGFRRRSEAGTFTLPPPPGEGNQRRIKLAVFSCANWGWGRFHAYDAAARGWGESLQL
DAWLHLGDYTYEYGDTHYPQADDAVRERFFALRPRGEATALRGYRERHALHRADEGLRAL
HAAAPVMAMWDDHDITNNAWTDGGENHQPETDGDYVARRRAGIRAFHEWLPTREPRARTG
DPKDDPDANLRYNRVAHFGDVASVVMLETRLLARTDPAGNPGGNVFANASGTIARWVAKR
ERAPARWRGSDLERTFLSLRDDLDAHRASPDREMLGAEQIAWIEKTTKASAALGVKWQVV
AQASPVMDMMSPDLAKGAAALDENARGDAPPPPRGHASWTAALRAWVDWNGDDDDDGGGR
TPNAKRVGVGGRDVPVDAARGLLAMGEYRLNWNFDDWHGYVADRAKLLRAVVPHANAAVI
LGGDSHDSWAGVVSDDARDWERPQGSTAAPRRVGAVEFDGPSVTPPGMFEHAHAWCPRAL
IDAGHLSSNPHTLRHARTGQRGFMLVDATAEEFAVDFVLTPSVRDASYSPRCDASFVARK
ESAGGDGGGGGGDGLRLDARTCPDLPDALARLSDRGGNGGDDAKAAPGAWAVTSLFVVAV
AFGAAGVVAGRHAPCFERSDGGGGGGGGGGRVGGGGHRRSSSAVDGYVSSNGGGGGDRKM
SARERRRYSELVDADVADSQLELGEWRDERRGGGGRHEREHSH
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcgcgtctcgacggcggcgacgcggctccggaccgcgtcctcgctcttcccc
gcgcgtcgaccgcccttccggatcctcctcctcctcctcctcctcctcgcgcgcgcgcgt
cgcgcggtcgcggaagcgaaccacggcgctttcgtgcacggcgtcgcctccggggacccg
acctccgacgcgatcgtcatctggacgcgcgtgacgccgacggggcgaaactaccccggc
ggcgtcgacccgcccgacgacatcacgttcgacgtgagatggaccgtcgcgacggcgccg
ccgcgcggccccgcggacgacgccgtcgacgccgcgtccgccgagcgcgacgacgacggg
acgtgggggagctccgagaccgcggtgggcgtcgacgcggacgccgcggcgtgggggttc
ccgcgcgggtcgatcgtcaagacgggcaccatcgcaggcgtgagcaacgagacggactgg
accgtgaagaaggacgtctccgggctgtcgcactcgacgcggtactactacgcgttcaac
atcgagcgcgacggcttcagacgccgctccgaggctggcacgttcacgctcccgccgccg
ccgggggagggaaaccagcggcggataaagctcgcggtgttctcgtgcgccaactggggg
tgggggcgttttcacgcgtacgacgccgcggcgcgagggtggggcgaatcgttacagctg
gacgcgtggctgcacctcggagattacacgtacgagtacggagacacgcactacccgcag
gcggacgacgccgtgcgcgagcgattcttcgcgctgcgtccgcgcggggaagctaccgcg
ctgcgaggctaccgcgaacggcacgcgttgcatcgcgcggacgaagggctgagagcgttg
cacgccgccgcgccggtgatggcgatgtgggacgaccacgacatcacgaacaacgcctgg
acggacggcggggagaaccaccagccggagacggacggcgactacgtcgcgcggcgacgc
gcggggattcgcgccttccacgagtggctgccgacgcgggaaccgcgcgcgagaaccggg
gacccgaaggacgatccggacgccaacctgcggtacaaccgcgtcgcgcacttcggcgac
gtcgcgagcgtcgtgatgttagagacgcggctgctcgcgaggacggacccggcggggaac
ccgggcgggaacgtgttcgcgaacgcgagcgggacgatcgcgcgctgggtcgcgaagagg
gaacgcgcgccggcgcgatggcgcgggagcgatttggagcgaacgtttctgtcgctgcgc
gacgacctggacgcgcatcgcgcgtcgccggaccgcgagatgctcggcgcggagcagatc
gcttggatcgagaagacgacgaaggcgtcggccgcgctcggcgtgaagtggcaggtggtc
gcgcaagcgtcgccggtgatggacatgatgtccccggatttggcgaagggcgctgcggcg
ttggacgagaacgcgcgcggcgacgcgccgccgccgccgcgcgggcacgcgtcgtggacc
gcggcgctgcgggcgtgggtggactggaacggcgacgacgacgacgacggcgggggaaga
acgccgaacgcgaagcgcgtcggcgtcggcgggcgagacgtccccgtggacgccgcgcgc
gggctgttggcgatgggagaataccgccttaactggaacttcgacgactggcacgggtac
gtcgccgaccgcgcgaagcttctgcgcgcggtcgtcccgcacgcgaacgcggcggtgatt
ctcggcggggactcgcacgactcctgggccggggtcgtgtccgacgacgcgcgcgattgg
gagcgccctcaggggtcgacggcggcgccgcgacgcgtcggcgccgtcgaatttgacggc
ccgtccgtgaccccgcccgggatgttcgagcacgcgcacgcgtggtgtccgcgcgcgctg
atcgacgccgggcacttatctagtaacccgcacacgctgcgacacgcgcggacgggacag
agggggttcatgctcgtggacgccaccgcggaggagttcgccgtcgatttcgtcctcacg
ccgtcggttcgagacgcgtcgtattcgccgaggtgcgacgcgtcgttcgtggcgagaaaa
gagagcgcgggcggcgacggcggcggcggcggcggcgacgggttaagactcgacgcgcgg
acgtgtccagacctcccggacgcgctcgcgcgcctctcggaccgcggcggaaacggcggg
gacgacgcgaaggcggcgcccggcgcctgggcggtgacgtcgctgttcgtcgtcgccgtc
gcgttcggcgccgcgggagtcgtcgcgggtcggcacgcgccgtgtttcgagcgaagcgac
ggcggcggcggcggcggcggcggcggcggccgagtcggcgggggcggacacaggcggtcg
agttccgcggtagacgggtacgtctcctcaaacggcggcggcggcggcgatagaaaaatg
tcggcgcgcgagcggcggcggtactccgagctcgtcgacgcggacgtcgcggactcgcag
ctggagctcggggagtggagggacgagcgacgcggtgggggggggaggcacgagcgcgag
cactcgcactga

DBGET integrated database retrieval system