KEGG   Micromonas pusilla: MICPUCDRAFT_58128Help
Entry
MICPUCDRAFT_58128 CDS       T02696                                 

Definition
histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mpp  Micromonas pusilla
Brite
Enzymes [BR:mpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MICPUCDRAFT_58128
Transcription machinery [BR:mpp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MICPUCDRAFT_58128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 470 aa AA seqDB search
MEAIRSFFGGSSAGTGGGDSDGPPDAKRARRDEEEASIGGSDSDSDADGGGGGGDDDDDG
GGGGGGGGANPGADGARGNANNPGGARDTLGQYAQREIHLRKQEDDGELVYKVIKNDGKE
QHSEWLVHLKNIFSKQLPNMPKEYIVRLVFDPRHHSMICLKNDAVIGGITYRPFWRQNVG
EIAFCAVSANEQVKGYGTRLMNHLKEYVCDKESMTHLITFADNNAVGYFQKQGFTKDVMM
EREKWVGYIKEYDGGTIMECSLSAQVSYTEFPIMIRQQRKCVDEVVKTMSNAHVVYPGLK
QFEQPPGPGGVYKPIPVDRIKGVKEAGWTPPGPPKYRLVHPGCGDGAPTPENLNRFMRAL
VNLVQNHIDVWPFLEPVNAEEVPDYYDVVKDPICMETIKDRVENGEYYVTLEMFAADFRV
MFNNCRLYNAPDTMFYKCATRLEAFFESKVAAGITWKASRGSVSGYLNRD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgatccggtcgttcttcggcggctcgtccgcggggaccggcggcggggactcg
gacggccccccggacgcgaagcgcgcgagaagggacgaagaagaggcgtcgatcggggga
tccgactctgactccgacgcggacggcggcggcggcggcggcgacgacgacgacgatggc
ggcggcggcggcggcggcggcggcgcgaacccgggcgcggacggcgcgcgcgggaacgcg
aacaacccgggcggcgcgagggacacgctcgggcagtacgcgcagcgcgagatccacctc
cggaagcaggaggacgacggcgagctcgtgtacaaggtgatcaagaacgacgggaaggag
cagcactcggagtggctcgtgcacttgaagaacatcttcagcaagcagctgccgaacatg
ccgaaggagtacatcgttcggttggtgttcgacccgaggcatcactcgatgatctgcctg
aaaaacgacgcggtcatcggcgggatcacgtaccggccgttctggcgacagaacgtcggc
gagatcgcgttctgcgcggtgagcgcgaacgagcaagtcaaggggtacggcactcggctc
atgaaccacctgaaggagtacgtctgcgacaaggagtcgatgacgcacctcatcacgttc
gcggataacaacgccgtcgggtatttccaaaagcaagggttcacgaaagacgtcatgatg
gaacgcgagaagtgggtcggatacatcaaagagtacgacggcgggacgatcatggagtgc
tccctcagcgcgcaggtttcgtacacggagttcccgatcatgatccgtcagcagagaaaa
tgcgtggacgaggtggtgaagacgatgtcaaacgcgcacgtcgtgtacccggggttgaaa
cagttcgaacaacccccggggccgggcggcgtgtacaagcccataccggtggatcggatc
aagggcgtgaaagaggcggggtggacgcccccggggccgccgaagtaccggctggtgcac
cccgggtgcggcgacggcgcgccgacgccggagaatctgaatcgattcatgcgcgcgctc
gtgaatttggtgcaaaatcacatcgacgtgtggccgttcttggagccggtgaacgcggag
gaggtgccggactactacgacgtcgtgaaggacccgatatgcatggagacgatcaaagat
cgcgtcgagaacggggagtattacgtcaccttagagatgttcgccgcggacttcagggtg
atgttcaataattgccgtctctataacgccccggacacgatgttttacaagtgcgcgacg
cggctggaggctttcttcgagagtaaggtcgccgcggggatcacgtggaaggcgagtcgg
gggtcggtgtcggggtacttgaaccgcgattag

DBGET integrated database retrieval system