KEGG   Micromonas pusilla: MICPUCDRAFT_60218Help
Entry
MICPUCDRAFT_60218 CDS       T02696                                 

Definition
histone acetyltransferase
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mpp  Micromonas pusilla
Brite
Enzymes [BR:mpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MICPUCDRAFT_60218
Transcription factors [BR:mpp03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    MICPUCDRAFT_60218
Mitochondrial biogenesis [BR:mpp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    MICPUCDRAFT_60218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1272 aa AA seqDB search
MQGPGNGASGPQPVGGMPSQGSAGTQWKTWQSDADIPQRKVLIQHILKLFRQRKPSETRE
WQQKLPDFVLRLEEAVYRGARSKEEYCNEATLEARLQAVARIMVARPRQGGGAQQPGGGV
GRVGGVGGQPTMQMVQPGGQPGTGGMQPNPNDPNMMMQMKQDPGGMMGGGGMGGMIMSNG
APVIRGAAAQGVSVGNVAMKGPGGMTAAQQQQMMMQQQQQQQQAMMMQQQQQAQQRAAAM
AAAGVNVKPGKKPTKAQEAQIAKHQKAQQAAMIAQQQQQQQQAMMAGGGRGGMGGRGGMG
GRGGGRGAPQQAQAANGGQPMTEDQIKKAYIVKQQRWLLFLRHASKCQAPEGKCQLTQQC
HVAKDLWKHVLQCLNPRCEYPRCIASRELLKHHQNCKDARCPVCGPVRSAMIKQRSHAMM
QAQQQQMQQQGGPAAKRARMDGGVMMPPPTQVKGTVGTKRPGGEGTSLMECFSPEEVRTH
LASLRLADKDVTAAKGQPMSARRRDAESEKAIAGATESACQACGVERLTFEPPPLYCYAC
VGRIKRGQVFYHIPPHVTGGEVRKDAWCNPCYNQIQGSIEVEGVKYPKNQLAKKKNDDDL
EEPWVQCDYCNCWYHQICVLFNGRKNTGGEAPFTCPSCILSQLDKKERAPTTNRPSSQLP
ASELPHTRLSFFLEERLKKVMTHERNERAKLLGKPIEEIPAADGLVIRVVSSVEKTLEVK
KNFKDAFKDQNFPERFPYRSKVLLLFQKTEGVDVCLLGIYVQEYGSDCPAPNNRRVYLSY
LDSVKYFRPSGIQVATGEGCALRTYCYHQILIGYLQYIKQRGFTSCFIWACPPFQGEDYI
LYCHPKEQKTPKSDKLREWYLKMLRQAQKEGIVLSLQNLYDEFHLGNQNHDIASATELPY
FDGDYFPGVAEDWIPGIQKEQAELAKKNKGKSAKQTTATARKTGKGKRLGVGTPEAELDV
ELMKKLGTTIHTMRHDFIMVHLAHQCTQCRKCIADDNRWYDSTPSASGAAFELCQECYDV
EQALESHEKKLTTGRDLVCERVDPLPDVKESDEVINSEFFDTRQAFLSLCQGNHFQFDSL
RRAKHTTMMVLYHLNNPSEPAFVATCNSCQRELEPGKGWRCETCPDFDICDDCKRMKGHE
HPLVRSGGRSDRGPGMTEEDRRVRAEQIQRTMELLVHATRCKDANCGSPNCTKVKHLFKH
AANCQLKAAGGCQLCRKMWTLLQVHANGCNDANCPVPRCKDLKAYRQRSQEQQDAKRRAR
YRVYMQEQQTGA
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
atgcagggccccggaaacggcgcctccgggccgcagcccgtgggcgggatgccgtctcaa
ggctccgcggggacgcagtggaagacctggcagagcgacgcggacattcctcagcggaag
gtgttgattcagcacatcctgaaacttttccgccaaaggaaaccgagcgaaacgcgagag
tggcagcagaagctcccggatttcgtgttgaggctggaggaggcggtgtaccgaggcgcg
cgcagcaaggaggagtactgcaacgaggcgacgctcgaggcgcggttgcaagctgtcgcg
cggatcatggtggcgcggccgcgtcaaggcggcggcgcgcagcaacccggcggcggcgtc
ggacgcgtcggcggcgtcggcggtcaaccgaccatgcagatggtccagccagggggtcaa
cccggaaccggagggatgcaaccgaacccgaacgatccgaacatgatgatgcagatgaag
caagaccctggcgggatgatgggggggggagggatgggcgggatgatcatgagcaacggc
gcgccggtgattcgaggcgccgccgcgcagggcgtcagcgtcgggaacgtcgcgatgaaa
ggcccgggcgggatgaccgcggcgcagcagcagcagatgatgatgcagcagcagcagcag
cagcagcaggcgatgatgatgcagcagcagcagcaggcgcagcagcgcgcggcggcgatg
gcggcggcgggggtcaacgtcaagcccgggaagaagccgaccaaggcgcaggaagcgcag
atcgcgaagcaccagaaagcgcagcaggctgcgatgatcgcgcagcagcagcagcagcag
cagcaggcgatgatggccggcggcggcagaggcggcatgggcggcagaggcggcatggga
ggcagaggcggcggacgcggggcgccgcagcaagcgcaggcggcgaacggagggcagccc
atgacggaggaccagatcaaaaaggcgtacatcgtgaagcagcagcgctggctgctgttc
ttgcggcacgcgagcaagtgccaagcgccggaggggaagtgccaacttacgcagcagtgc
cacgtcgcgaaggatctgtggaagcacgtgttgcagtgcttgaacccgcggtgcgagtat
ccgcggtgcatcgcgtcgagggagctcctgaagcaccaccaaaactgcaaggacgcgcgg
tgcccggtctgcggccccgtgcgaagcgcgatgatcaagcagcggtcgcacgcgatgatg
caggcgcagcagcagcagatgcagcagcagggcgggcccgcggcgaaacgcgcgaggatg
gacggcggcgtcatgatgccgccgccgacgcaagtcaagggcaccgtcggcacgaagcgc
ccgggcggggaagggacgtcgctcatggagtgcttctccccggaggaggtgcgcacgcac
ctcgcgtcgctgcgtctcgcggacaaggacgtcaccgcggcgaaagggcagccgatgtcc
gcgagaagacgcgacgcggagagcgagaaggcgatcgccggcgcgacggagtcggcgtgc
caagcgtgcggcgtcgagcggctgacgtttgagccgccgccattgtattgctacgcgtgc
gtcgggcggatcaaacgcgggcaggttttctaccacatcccaccgcacgtcaccggcggg
gaagtgcgcaaagacgcgtggtgtaacccgtgttacaaccaaattcaaggctcgatcgag
gtggagggcgtcaagtacccgaagaatcagctcgcgaagaagaagaacgacgacgacttg
gaagagccgtgggtgcagtgcgactactgcaactgctggtaccaccagatttgcgtgctg
ttcaacgggaggaagaacaccggcggggaggcgccgttcacgtgcccgagctgcatctta
tcgcagttggataagaaggagcgcgcgccgacgacgaaccggccgtcgtcgcagctcccg
gcgtcggagctcccgcacactcggttgtcgttcttcttggaggagagactgaagaaggtg
atgacgcacgagcggaacgaacgcgcgaagttgctcgggaagcccatcgaggagatcccc
gccgcggatggtctcgtcatccgcgtcgtctccagcgtcgagaagacgctcgaggtgaag
aagaacttcaaagacgccttcaaggaccaaaactttccggagcgatttccgtaccggagc
aaggttttactcttgttccaaaagaccgagggcgtggacgtgtgcttgctcggcatttac
gtccaggagtacggcagcgactgccccgcgccgaacaaccggcgcgtgtacttgtcctac
ctcgacagcgtgaagtacttccgcccgagcgggattcaagtcgcgacgggcgaaggctgc
gcgctgcggacgtattgctaccatcagattttgatcgggtacctgcagtacatcaaacag
cgagggttcacgtcgtgcttcatctgggcgtgcccgccgttccaaggcgaggactacatc
ttgtactgccacccgaaggagcagaagacgccgaagagcgacaagctccgcgagtggtac
ctcaagatgttgaggcaggcgcaaaaggagggcatcgtcctgtcgctccagaatttatac
gacgagtttcacctcgggaaccagaaccacgacatcgcgtccgcgacggagctgccgtat
ttcgacggcgattacttccccggcgtcgcggaggactggatcccgggcatccagaaggaa
caagccgagctcgcgaagaagaacaagggcaagagcgctaagcagacgacggcgacggcg
cggaagacgggcaagggcaaacgcctgggcgtcggcacccccgaggctgagctcgacgtc
gagctcatgaagaagctcgggacgacgatccacacgatgcgtcacgacttcatcatggtc
cacctcgcgcaccagtgcacgcagtgtaggaagtgcatcgcggacgacaaccggtggtac
gactccacgccgtcggcgtcgggcgccgcctttgagctgtgccaggagtgctacgacgtg
gagcaggcgttggagtcgcacgagaagaagctcacgacggggcgggatctcgtgtgcgaa
cgcgtggacccgctgccggacgtcaaggagagcgacgaggtgatcaactcggagtttttc
gacacgcgacaggcgttcctctcgctgtgccaagggaaccacttccaattcgactcgctt
cgacgcgccaagcacacgacgatgatggtgttgtatcacctcaacaacccgtccgagccc
gcgttcgtggcgacgtgcaacagctgtcaacgcgagctcgagcccggcaaggggtggcga
tgcgagacgtgcccggactttgacatctgtgacgactgcaagcgcatgaagggccacgaa
cacccgctcgtgcgaagcggcgggagaagcgaccgcgggccggggatgacggaggaggac
agacgcgtgcgcgcggagcagatccaacgcacgatggagctgctcgtgcacgcgacgcgg
tgtaaggacgcgaactgcgggtcgccgaactgcaccaaggtgaagcatctcttcaagcac
gcggcgaactgccagctgaaggctgcgggggggtgccagctgtgtcggaagatgtggacg
ctgctgcaggtgcacgccaacgggtgcaacgacgccaactgcccggtgccgcggtgcaag
gatctcaaggcgtacaggcagcggtcgcaggagcagcaggacgcgaagcggcgcgcgcgg
taccgtgtgtacatgcaggagcagcagacgggggcgtga

DBGET integrated database retrieval system