KEGG   Micromonas pusilla: MICPUCDRAFT_70815Help
Entry
MICPUCDRAFT_70815 CDS       T02696                                 

Definition
o-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mpp  Micromonas pusilla
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MICPUCDRAFT_70815
  Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    MICPUCDRAFT_70815
Enzymes [BR:mpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MICPUCDRAFT_70815
Exosome [BR:mpp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MICPUCDRAFT_70815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 309 aa AA seqDB search
MSHAASTSGRSACAGRVRADGVRRNTSKSAARDGNATAAPTRRAALISLLSSRVLVETPP
SARAKTTFVKDPSFYAEWSYAQPSDIIPYVEATAPRGDARAVLAAMDVFGEYYPMYKLGD
EKGRILATIVRDRSPSKAVEVGTFLGYSAIWTALNLPPGGTLTCVEFEPRHVAVARALTT
YAGVGDVVTILQGAGAERVSDVKKIIGQDDVADMVFFDHCKECYLPDLRSFEDAGIVGKG
TVVVADNVLYPGAPDFLSYVDTAAGRYDTKLYDAAFEYDQVWKKDWTPQADALSYSVCRG
PVEDAEVVL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacgcggcgtcgacgagcgggcggagcgcgtgcgcgggacgcgtccgcgccgat
ggcgtccgtagaaacacgtcgaaatccgcggcgcgcgacgggaacgcgacggcggcgccg
acgcgacgcgcggcgctcatctcgctgctgtcctctcgcgtcctcgtcgagacgccgccg
tccgcgcgcgcgaagacgaccttcgtgaaagacccgtcgttctacgcggagtggtcgtac
gcgcagccgtcggacatcatcccgtacgtggaggcgaccgcgccgaggggcgacgcgcgc
gcggtcctcgccgcgatggacgtcttcggggagtactatcccatgtacaagctcggggac
gagaagggacggatactcgcgaccatcgttcgcgaccgatcgccgtcgaaggcggtggag
gtggggacgttcttggggtacagcgcgatatggaccgcgctgaacctgccccctggggga
accctcacgtgcgtggagttcgagccgaggcacgtcgcggtcgcgcgcgcgctgacgacg
tacgcgggggtgggcgacgtggtgaccatcttacaaggcgcgggcgcggagcgcgtctcg
gacgtgaagaaaatcatcggtcaggacgacgtcgcggacatggtgttcttcgatcactgc
aaggagtgttacctcccggatctgcggagcttcgaggacgcggggatcgtcgggaagggg
acggtcgtcgtcgcggacaacgtgctgtatccgggcgcgccggattttctgtcgtacgtc
gacacggccgcggggcggtacgacacgaagttgtacgacgccgcgttcgagtacgatcaa
gtctggaagaaagattggacgccgcaggcggacgcgctgtcgtactccgtgtgtcgcgga
ccggtcgaggacgcggaggtagttttatag

DBGET integrated database retrieval system