KEGG   Moniliophthora perniciosa: MPER_00316Help
Entry
MPER_00316        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MPER_00316
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    MPER_00316
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     MPER_00316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 192 aa AA seqDB search
WAASPVFDPVSGFGGNGADIPGYTGFFGNISQFPDWQFGAPGGGCIQDGPFASYNLSLGP
GTTNTNRCISRWFNPAYLPNLSEQNVSRLLQFDNFEDFRIQLEGIPVTEHTLTHDGGHIA
VGGDMADKYSSPGDPLFYLHHANLDRIWWKWQIAEPSCRLYNISGRSTVNPPYRDVTLNF
FLPAMGLGQDMP
NT seq 577 nt NT seq  +upstreamnt  +downstreamnt
ctgggccgcttccccagtctttgatccagtttccgggtttggagggaacggtgccgatat
acctggatacaccgggttcttcggtaacatctcccaattccccgactggcagttcggggc
tcctggaggagggtgcattcaagacggcccatttgcatcctataacctctcgctcggccc
tggaactacgaacacaaaccgctgtatctcgcgatggtttaacccagcgtatctcccaaa
cctctccgagcagaacgtctccagacttcttcagtttgacaactttgaagattttaggat
ccagttggagggcatcccggtcaccgaacacacattaacccatgatggtggtcatattgc
ggtcggtggtgatatggctgacaaatattcaagcccaggagatcctctattctacctaca
tcatgccaatttggatcgcatttggtggaagtggcagatagccgaaccttcatgcagact
atacaatatcagtggtcgatccacagtcaatccaccgtaccgagacgtcactctaaactt
cttcctcccagcgatggggctaggacaggacatgccg

DBGET integrated database retrieval system