KEGG   Moniliophthora perniciosa: MPER_00353Help
Entry
MPER_00353        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpr  Moniliophthora perniciosa
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPER_00353
   00052 Galactose metabolism
    MPER_00353
   00500 Starch and sucrose metabolism
    MPER_00353
   00520 Amino sugar and nucleotide sugar metabolism
    MPER_00353
Enzymes [BR:mpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MPER_00353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 151 aa AA seqDB search
TKTLNKLAVLKVNGGLGTSMGMTGAKSALEVKDDMTFLDLTVRQIEHLNTTNRVDVPLIL
MTSFNTHEDTLRIIKKYANQQLRITTFNQSRYPRILKETLMPLPKRADDDKKNWYPPGHG
DLYNALLHSGVLDQLLAEGKEYLFVGQNQIT
NT seq 458 nt NT seq  +upstreamnt  +downstreamnt
acaccaagactctcaacaaactcgctgtgctcaaagtcaatggtggtcttggtacttcca
tgggtatgactggtgcaaagagtgctcttgaagtcaaggatgatatgaccttcctcgatc
tcactgttcgtcaaattgaacaccttaacaccaccaatcgtgtcgacgtccccctcatcc
tcatgacatcgttcaacacccacgaagacacccttcggataatcaaaaagtacgccaacc
agcagttgcgtatcaccaccttcaaccagtcgagatatcctcgcatcttgaaggaaaccc
tcatgcccttgccgaagagggctgatgatgacaagaagaactggtacccgcccggtcacg
gtgacctctacaacgctctcctccactccggcgttcttgatcagctcctcgctgaaggaa
aggaatacctcttcgtggggcaaaaccagataacctag

  All links  
No link information was found.   
DBGET integrated database retrieval system