KEGG   Moniliophthora perniciosa: MPER_01563Help
Entry
MPER_01563        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
mpr  Moniliophthora perniciosa
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:mpr04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 228 aa AA seqDB search
MAMKEIRLELEQSKLNAIIMELDILHRASISSENIVEFYGAFFIESCVYYCMEYMDAGSL
DKLVNYPLGETVPVPGGDPEQIEWEGVPEQVLARICGSMVKGLKFLKDELGVIHRDVKPT
NVLVNKKGQIKLCDFGVSGQLEKSLAKTNIGCQSYMAPERIKGESQNNLGTYTVSSDVWS
LGLSIIEIAIGCYPYPPESYSNVFAQLTAIVHDDPPDLPLNRSNPMRI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaaggaaatccgtctcgaacttgaacagtcaaaactcaacgccatcatcatg
gaattggacatccttcatcgagcgtcaatcagttctgagaacatcgttgaattttacggt
gccttcttcattgaaagctgcgtttactactgcatggagtatatggacgcaggatcgtta
gacaaactagtcaattatcctcttggcgaaacagtgcctgttcctggtggtgacccagag
cagatcgaatgggaaggtgtgccggagcaggtactagcgagaatatgtgggtcgatggtg
aagggtttgaagttccttaaagacgagttgggcgtcattcatcgagatgtcaagccgacg
aacgtgctcgtcaacaagaagggccagatcaagctttgcgatttcggtgtatccggtcag
cttgagaaaagtttggcaaagacgaatattggatgtcagagttacatggctcccgagaga
atcaagggagagtctcagaacaatctcggtacctacactgtctcctcggatgtctggtcg
ctcggcctttcgatcattgaaatcgccataggatgttacccctatccgccagaatcctat
tcaaacgtgtttgcacaactcaccgcaatcgtgcacgatgacccacccgatttgccgcta
aaccggagcaaccctatgcggatttaa

DBGET integrated database retrieval system