KEGG   Moniliophthora perniciosa: MPER_01563Help
Entry
MPER_01563        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
mpr  Moniliophthora perniciosa
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MPER_01563
Enzymes [BR:mpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     MPER_01563
Protein kinases [BR:mpr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   MPER_01563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 228 aa AA seqDB search
MAMKEIRLELEQSKLNAIIMELDILHRASISSENIVEFYGAFFIESCVYYCMEYMDAGSL
DKLVNYPLGETVPVPGGDPEQIEWEGVPEQVLARICGSMVKGLKFLKDELGVIHRDVKPT
NVLVNKKGQIKLCDFGVSGQLEKSLAKTNIGCQSYMAPERIKGESQNNLGTYTVSSDVWS
LGLSIIEIAIGCYPYPPESYSNVFAQLTAIVHDDPPDLPLNRSNPMRI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaaggaaatccgtctcgaacttgaacagtcaaaactcaacgccatcatcatg
gaattggacatccttcatcgagcgtcaatcagttctgagaacatcgttgaattttacggt
gccttcttcattgaaagctgcgtttactactgcatggagtatatggacgcaggatcgtta
gacaaactagtcaattatcctcttggcgaaacagtgcctgttcctggtggtgacccagag
cagatcgaatgggaaggtgtgccggagcaggtactagcgagaatatgtgggtcgatggtg
aagggtttgaagttccttaaagacgagttgggcgtcattcatcgagatgtcaagccgacg
aacgtgctcgtcaacaagaagggccagatcaagctttgcgatttcggtgtatccggtcag
cttgagaaaagtttggcaaagacgaatattggatgtcagagttacatggctcccgagaga
atcaagggagagtctcagaacaatctcggtacctacactgtctcctcggatgtctggtcg
ctcggcctttcgatcattgaaatcgccataggatgttacccctatccgccagaatcctat
tcaaacgtgtttgcacaactcaccgcaatcgtgcacgatgacccacccgatttgccgcta
aaccggagcaaccctatgcggatttaa

DBGET integrated database retrieval system