KEGG   Moniliophthora perniciosa: MPER_01921Help
Entry
MPER_01921        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MPER_01921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 137 aa AA seqDB search
LGWSYPCDAYSLGCILVEFFTGVALFQTHDNLDHLAMMEVVMGKMPDRFARAGARSKPEF
FKDGAKLDWPKPKASRQSRKDVRSVRPLAEIIPQTDLINRQFLDLVRKLLAFDPAQRLTV
ADAIKHPYFSMHIPEEL
NT seq 416 nt NT seq  +upstreamnt  +downstreamnt
gtctaggatggtcatatccgtgcgacgcttactcgttgggatgcattctagtggagttct
tcaccggagtggccctttttcaaactcatgacaaccttgatcatctggcgatgatggagg
tggttatgggaaagatgcctgatcgtttcgctcgcgcaggagctcgatcaaaacctgaat
tcttcaaagacggtgccaaattagactggccgaagcccaaggcatctcgtcagagcagga
aggatgtgcggtcagtgcggccgttagcggaaatcatacctcaaacggacttgattaaca
ggcagtttctggatctcgtccgaaaattattagcgttcgatcccgcacagcggttgactg
ttgcagatgcgatcaagcacccgtatttctcgatgcatattccggaagagttataa

DBGET integrated database retrieval system