KEGG   Moniliophthora perniciosa: MPER_02025Help
Entry
MPER_02025        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
mpr  Moniliophthora perniciosa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MPER_02025
Translation factors [BR:mpr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    MPER_02025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 171 aa AA seqDB search
PPKKKGTLKQKLAEKEAAKAAKKDEDDAYDSDAVLDPREKARLDKEKELNSDLNNAAELF
GAAALGGTSSKELDSLISFQPRTKEDFIELSSRIIEFVVKRHQNKPLYATFVEHHVRELA
TPLKDVEVRKAASGLTTLANEKQKEQREKASGKKKKGSAKPGLGAAKVSNK
NT seq 518 nt NT seq  +upstreamnt  +downstreamnt
caccaccaaagaagaaaggcaccctcaagcaaaagttggcggagaaagaagccgcaaagg
cggcaaaaaaggacgaggacgacgcgtacgattccgatgctgtattggaccccagagaga
aggccaggctggacaaagagaaagagttaaattctgatctcaacaatgctgcagaattat
ttggagcagctgctctcggaggaacttcgtcaaaggaacttgactctttgatttctttcc
aaccgcgaactaaggaggacttcatcgaactctcatctcggataatagaattcgtggtca
agcgacaccagaacaaaccactgtatgccacatttgttgagcatcatgtccgagagcttg
caacacctctgaaagacgtggaagtaaggaaggcagctagcggcttgactacattggcca
acgagaagcagaaggagcagagagaaaaagcgagcgggaagaagaagaaagggtcggcaa
aacctggccttggcgcggcgaaggtttcaaacaagtaa

DBGET integrated database retrieval system