KEGG   Moniliophthora perniciosa: MPER_02058Help
Entry
MPER_02058        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mpr  Moniliophthora perniciosa
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MPER_02058
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MPER_02058
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MPER_02058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 156 aa AA seqDB search
MPPSVTSTSTSVTLLSESEVSVTVAEYVLAAAKGMSSSGVAPCVKHFPGHGDTHVDSHLA
LPKIMKTKQVITETELVPFKTAFDEAQSNPRLGSLLTVMTSHHALPLITGSDEPCSLSKV
ITTEMLRKEMGFKGVVVTDCLEMDAIAATKDDDGAQ
NT seq 469 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgtcggtgacatcaacatcgacaagcgtaaccctgttatcggagtccgaagtt
tcggtgacggtagccgaatatgtgttggcagcagccaaaggcatgtccagctcaggagtc
gcaccctgtgtcaaacacttcccaggacacggtgacacacacgtcgattcccatcttgca
cttcccaaaattatgaaaacaaaacaagtcatcacagaaaccgagctcgtcccattcaaa
acagcgttcgacgaagcacagtcaaatccgcgccttggaagcttgttgacggtgatgacc
agccatcatgctctcccattgattaccggaagcgatgagccatgttcattgtcaaaggtg
attacgaccgagatgttgaggaaggaaatgggtttcaagggtgtggttgtcactgattgt
ctggaaatggatgcgatagcggcgaccaaggatgacgatggcgcgcagg

  All links  
No link information was found.   
DBGET integrated database retrieval system