KEGG   Moniliophthora perniciosa: MPER_02132Help
Entry
MPER_02132        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mpr01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mpr01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 107 aa AA seqDB search
MGDSRLECITAGYHRLWAHRAYNASLPLQYVLALFGAGAVQGSIKWWSRGHRAHHRYTDT
ELDPYNAHKGFWYAHIGWMLVKPRRRPGVADVSDLSKNPVVRWQHKC
NT seq 322 nt NT seq  +upstreamnt  +downstreamnt
atgggagactctcgtttggagtgtatcacggcaggataccaccgcctatgggctcatcgt
gcctacaacgcgtcgctcccgttgcaatatgttctggctttgtttggcgccggtgcggtc
caaggaagtatcaagtggtggtcgcgaggacaccgtgctcaccaccgatacactgacact
gaattggatccatacaacgcccacaagggtttctggtacgcgcacattggctggatgctc
gttaaacccaggagaaggcctggggtcgcggacgttagtgacttgagcaagaacccagtc
gtcaggtggcagcacaagtgcg

DBGET integrated database retrieval system