KEGG   Moniliophthora perniciosa: MPER_02424Help
Entry
MPER_02424        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mpr  Moniliophthora perniciosa
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MPER_02424
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MPER_02424
Transfer RNA biogenesis [BR:mpr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MPER_02424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 259 aa AA seqDB search
HALTDSVFNKLVKNETLTKGDKSPVTARCYDMLIPRILSYERRHAAELRAESGATLRDRI
VELTNEALTRELGEGDYAEWGIGPGKAKSTEELLDAIDRGNHTGGRTGRMWCIDPIDGTK
GFLRGEQYAVCLALIVDGHVQVGVIGCPNLPADLSKPDEAKGRIFVAVREQGAQQMSLTG
ANPEPLSMPPYNPSTFNFLESVEAAHSSHSTNDKISALMGITRPPIRMDSQAQYGCLARG
DGGAYMRMPTGVGYLEKIG
NT seq 778 nt NT seq  +upstreamnt  +downstreamnt
ggcatgcactgaccgactcggttttcaataaactcgtcaagaacgagactttgacgaaag
gagacaagtcaccggtgactgctcgatgctacgacatgcttatcccgaggatcctatcgt
atgagaggaggcacgcagccgaattgcgcgcagaatcaggagcaacactccgtgaccgaa
ttgtagagctaaccaatgaagcattgacccgcgaactcggcgaaggagattacgcagaat
ggggcattggtcctggaaaggcaaagtcaacagaagagttactcgatgccattgatagag
ggaaccatactggtggcaggactggccgtatgtggtgtatcgatcctatcgatggaacaa
aaggcttcttacgaggagaacagtacgcagtctgcttggctctgattgtcgatggccatg
ttcaagtcggtgtcattggatgcccaaaccttcccgccgatctctcaaagccagacgaag
ctaaaggacgcatttttgttgccgttcgggagcaaggggcccagcagatgtctctgacag
gcgccaaccccgagcctctatccatgcctccttacaacccatctaccttcaatttcctgg
aatctgtcgaggctgcacattcatctcattccacaaatgacaagatttcggcgttgatgg
gcattactcggccccccattcgcatggatagtcaagcccagtacggctgtctggcccgtg
gtgacggaggtgcttatatgagaatgccaaccggcgttggatatctcgagaagattgg

DBGET integrated database retrieval system