KEGG   Moniliophthora perniciosa: MPER_02434Help
Entry
MPER_02434        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00020  Citrate cycle (TCA cycle)
mpr00310  Lysine degradation
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
mpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MPER_02434
  Amino acid metabolism
   00310 Lysine degradation
    MPER_02434
Enzymes [BR:mpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MPER_02434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-ProteinID: EEB98115
UniProt: E2L8Y6
AA seq 101 aa AA seqDB search
ARDGKLTLEDMAGGTFTISNGGVFGSLYGTPIINLPQSAVLGMHAIKDRPVAVNGQVVIR
PIMVVALTYDHRLLDGREAVTFLVKVRDYLEDPRKMLLTSA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gcccgggatggtaagcttacccttgaagacatggctggcggcaccttcaccatctcgaat
ggcggcgtctttggctcattgtacggtacccccatcatcaacctgccacaatctgctgtg
ctgggtatgcatgcaatcaaggaccgacctgtcgctgtgaacggccaagtcgtgattcga
cccatcatggtcgttgccctaacctacgaccatcggttactagacggcagggaggctgtg
actttcctcgtgaaagtcagggactacctcgaggatcctagaaagatgttgctcacctct
gcataa

DBGET integrated database retrieval system