KEGG   Moniliophthora perniciosa: MPER_02532Help
Entry
MPER_02532        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mpr  Moniliophthora perniciosa
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mpr00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mpr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 264 aa AA seqDB search
MFRIDPDEGRILYDSKKSGIIPIEAIKELRFGSDASYYRAQLEFPLSAESRWITVVFILE
GKYKTMHVLAPSVDAFNLWKTALEKLFKIRQGLMVGLQNNSLRDAVWEKQYWKGADENND
QKLDFKDVQSLCIRLSLNFSDEELKTLFRRFVELIKRRPEIEAIYDKYSELNGGKFTLVA
FTNFLRGSQKSKLSDEAIKSVFTKYTQSQNAPENDIEMTLEVFSTFLCSEDNCVFPEFYQ
PITHELTKPISEYYILSAHNTYLN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaatagatccagatgaagggaggatcttgtacgactcaaagaagagtggtatt
ataccaatcgaggccatcaaggagctcagattcggttctgatgctagctactatcgcgcg
cagcttgaattcccactctcagcagaaagtcgttggatcacggtcgtgttcattctggaa
ggcaaatacaagacgatgcatgtccttgcgccaagtgtggatgccttcaatctttggaag
actgctctggagaagcttttcaagattcggcagggtctgatggttggtctccagaataac
agcctaagagacgcagtctgggagaaacagtactggaagggagcggatgagaacaatgat
cagaagctggatttcaaggacgtacagagcctttgtatcaggcttagtctcaacttctct
gatgaagagctgaaaacattgttcaggcggttcgttgaactcatcaagcgaagaccggaa
atagaggccatctatgacaagtacagtgaactgaacggaggcaaatttaccttggtggcc
ttcacgaacttcctgcgtggatcccagaagtctaagctatctgacgaagcgataaaaagc
gtcttcaccaagtacacccagtctcaaaacgccccagagaatgatatcgagatgactctg
gaagtattctcgacgttcctttgctccgaggataattgtgttttcccagaattttatcaa
ccaatcactcatgaattgaccaaaccgatttctgaatactatattttatcggcacacaac
acttacttgaattga

DBGET integrated database retrieval system