KEGG   Moniliophthora perniciosa: MPER_02532Help
Entry
MPER_02532        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mpr  Moniliophthora perniciosa
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MPER_02532
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MPER_02532
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     MPER_02532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 264 aa AA seqDB search
MFRIDPDEGRILYDSKKSGIIPIEAIKELRFGSDASYYRAQLEFPLSAESRWITVVFILE
GKYKTMHVLAPSVDAFNLWKTALEKLFKIRQGLMVGLQNNSLRDAVWEKQYWKGADENND
QKLDFKDVQSLCIRLSLNFSDEELKTLFRRFVELIKRRPEIEAIYDKYSELNGGKFTLVA
FTNFLRGSQKSKLSDEAIKSVFTKYTQSQNAPENDIEMTLEVFSTFLCSEDNCVFPEFYQ
PITHELTKPISEYYILSAHNTYLN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaatagatccagatgaagggaggatcttgtacgactcaaagaagagtggtatt
ataccaatcgaggccatcaaggagctcagattcggttctgatgctagctactatcgcgcg
cagcttgaattcccactctcagcagaaagtcgttggatcacggtcgtgttcattctggaa
ggcaaatacaagacgatgcatgtccttgcgccaagtgtggatgccttcaatctttggaag
actgctctggagaagcttttcaagattcggcagggtctgatggttggtctccagaataac
agcctaagagacgcagtctgggagaaacagtactggaagggagcggatgagaacaatgat
cagaagctggatttcaaggacgtacagagcctttgtatcaggcttagtctcaacttctct
gatgaagagctgaaaacattgttcaggcggttcgttgaactcatcaagcgaagaccggaa
atagaggccatctatgacaagtacagtgaactgaacggaggcaaatttaccttggtggcc
ttcacgaacttcctgcgtggatcccagaagtctaagctatctgacgaagcgataaaaagc
gtcttcaccaagtacacccagtctcaaaacgccccagagaatgatatcgagatgactctg
gaagtattctcgacgttcctttgctccgaggataattgtgttttcccagaattttatcaa
ccaatcactcatgaattgaccaaaccgatttctgaatactatattttatcggcacacaac
acttacttgaattga

DBGET integrated database retrieval system