KEGG   Moniliophthora perniciosa: MPER_02624Help
Entry
MPER_02624        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mpr  Moniliophthora perniciosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 219 aa AA seqDB search
MASTSSSDIFILTIGVVLAALYLFRDQLFAASKPKSIPVPTKIANGDGGNPRDFVAKMKA
GKKRLVIFYGSQTGTAEEYAIRLAKEAKAKFGLTSLVCDPEEYDFENLDELPEDCCAFFV
MATYGEGEPTDNAVQLMQNMTDESFEFTNGAHKLEGLKYVVFALGNQTYEHYNLIGRQID
EHLTKMGAVRIGERGEGTTTKLGKDTAMDGVLGRFAGIT
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgacttcttcatcagacatcttcattcttactataggtgtcgtcctagcggcg
ctctacctcttccgcgaccagctcttcgctgcatccaagcccaagtccattccagtaccg
accaagatcgccaatggcgatggaggcaacccacgagactttgttgcaaaaatgaaagct
ggtaaaaaacgtctggtcatcttctacggctcacagactggtaccgccgaggagtacgcc
attcgtctcgccaaagaggctaaagccaagttcggactcacatcattggtctgtgacccc
gaggaatatgatttcgagaaccttgacgagcttccagaggactgctgtgcgttcttcgtc
atggccacctatggagagggtgagcctaccgataacgctgtccagctcatgcaaaacatg
acggacgagtctttcgaattcacgaacggtgctcacaagctcgagggtctcaaatacgtc
gtctttgctcttggaaaccagacatatgagcactacaacctcattggtcgtcaaattgac
gagcatttgaccaaaatgggcgctgtccgtattggggagcgtggggagggtaccaccaca
aagcttggaaaagacactgcgatggacggtgttttgggacgcttcgcaggcataacttaa

DBGET integrated database retrieval system