KEGG   Moniliophthora perniciosa: MPER_02630Help
Entry
MPER_02630        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mpr  Moniliophthora perniciosa
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPER_02630
   00500 Starch and sucrose metabolism
    MPER_02630
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     MPER_02630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 188 aa AA seqDB search
MYNVNIANTYGPGKQATALSAKNSNQGYYGCKITGYQDTLLADGPGYQYYSNCYIEGAVD
YIYGKASAWFGECTLSSNDSGAITANSRESSSDPGYYVIDSSTITSSVSGLTQKVYLGRP
WRALARVSFQRSTLPDLINPKGYTTLADNATPIFMEYQNTGTGADTSQRVTFTKQTALLT
HEQVLGSD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatgtcaacatcgccaatacctacggaccgggaaagcaggccaccgccctgtcg
gcgaagaactccaatcaaggctactatggctgtaagataacaggataccaggacaccctc
ttggcagacggccccggatatcaatattattccaactgctacatcgaaggtgcagtcgac
tacatctacggcaaggcttccgcgtggtttggtgaatgtacactttcctccaatgactct
ggcgctatcacagccaactcgagagaatccagcagtgatcctggatactatgtgatcgat
agctcaacgatcacgagctcagtttcgggtttgacccagaaggtttaccttggacggcca
tggagggctctagcacgagtctctttccagcgttcgactctcccggatctgatcaaccca
aagggctacacaacattggcggataacgcaactccgatcttcatggagtatcagaacact
ggcaccggtgcagacacgtctcaacgggtgacgttcacaaagcagacggcacttctgacc
cacgagcaagtgctaggatcggattag

DBGET integrated database retrieval system