KEGG   Moniliophthora perniciosa: MPER_03004Help
Entry
MPER_03004        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MPER_03004
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPER_03004
  Lipid metabolism
   00071 Fatty acid degradation
    MPER_03004
  Amino acid metabolism
   00350 Tyrosine metabolism
    MPER_03004
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MPER_03004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 129 aa AA seqDB search
MTIDIPKTAKAAVINEFNRPLDLQDWPVKQPSELAPGECLIKLAFAGCCHSDLHVKENEW
GFSAKLPLVGGHEGIGHIVAIGEHTINSPVKIGDRVGLKWIASSCLRCEMCKKXKEARSH
GFTGHRDFC
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgactattgatattccaaagaccgccaaggctgctgtcattaacgagttcaacagaccg
ctagatcttcaagattggccagtcaagcaaccttccgagcttgcacccggagaatgtctt
atcaagctggcctttgctggatgttgtcattcggacttgcatgtcaaggagaacgaatgg
ggtttctcagcgaagcttcctctggtgggaggacacgaaggcattgggcatattgtagcg
atcggggagcatactatcaacagtccagtcaagattggtgatagagttgggttgaagtgg
atcgcatcctcgtgtttaaggtgtgaaatgtgcaagaaggnaaaagaagctcgtagccac
ggcttcaccggacaccgggacttttgctga

DBGET integrated database retrieval system