KEGG   Moniliophthora perniciosa: MPER_03042Help
Entry
MPER_03042        CDS       T01089                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  
translation initiation factor 4E
Organism
mpr  Moniliophthora perniciosa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MPER_03042
Messenger RNA biogenesis [BR:mpr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     MPER_03042
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     MPER_03042
Translation factors [BR:mpr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MPER_03042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 126 aa AA seqDB search
MASTLTGPALTASRMALSAAIADHPEVEDSSVETGEIQEVNMESQAESIRTVFSDPTNFN
VKHPLYSSWTLWFDSPMTKGRNLPQTPISAFPQTPVVQTPGPAAAQGWMEDIKRVISFDS
VEEFWG
NT seq 377 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaactttgaccggtccagctctcactgcttccaggatggcgctctcagctgct
attgctgatcaccccgaggtcgaggattcctctgtggaaactggagaaatccaagaagtc
aacatggagtcccaggcagagagcattcgtaccgtcttcagcgatcccacaaatttcaat
gtcaagcatcctctctactcttcttggaccctttggttcgactccccaatgaccaagggt
cgaaatcttccccaaactccaatctccgccttcccccaaacaccagtcgtccaaacgcct
ggacccgctgccgcacagggttggatggaggatatcaaacgtgtcattagctttgacagt
gtcgaagaattctgggg

DBGET integrated database retrieval system