KEGG   Moniliophthora perniciosa: MPER_03145Help
Entry
MPER_03145        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K18669  dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    MPER_03145
Enzymes [BR:mpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MPER_03145
Protein kinases [BR:mpr01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   MPER_03145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Choline_kinase
Motif
Other DBs
NCBI-ProteinID: EEB97517
UniProt: E2LAN4
AA seq 390 aa AA seqDB search
STNATAANESSTSHRFSALSPSKGLKLLSPKISLSSARSSNTASTQNLVTGTPSSSRQSL
STPSPAPSSVDDEELAGDEEMLHYIRRQQAKKLQNGATQEELDELLKFPEPIPPAESLSP
TAVLNSSQRQYLSEYEQKEILDFPMCTILVNEARRILQLWIILRTITAMMMTVPTIWWSI
VTTLHSAMRDHCTGESVAIKIIRNKKRFHHQALVEIKILDSLRKWDADEKHHVIKMTEHF
YFRNHLCIAMELLSINLYELIKANGFVGFTTALIRRFTSQMLLSLSLMRHHRIVHCDLKP
ENVLLRHPAKSAIKVIDFGSSCFEHEKIYTYIQSRFYRSPEVILGMNYHMAIDMXSLGCI
LAELYTGFPIFPGEMSXTAFMYHGXSWRAR
NT seq 1175 nt NT seq  +upstreamnt  +downstreamnt
tgtctacgaatgccaccgccgccaacgagtcctcgacttctcatcgcttttccgctcttt
cgccatccaagggactcaaacttcttagccccaagatttctttgtcatctgctcgttctt
ccaatacagccagcacccagaatctcgtaactggtacaccaagctcgagcaggcagtcgt
tgtccacaccttcacctgctcccagctccgtcgatgacgaagagttggccggtgacgaag
aaatgctgcactacattcgcaggcaacaagccaagaaattacagaatggtgctacacagg
aagaactagacgagcttctcaagttccccgagccaatacctcccgcagaatccctttctc
ctacagctgtcctcaacagtagccagcgccagtatctatcggaatatgagcagaaagaga
tcctcgacttccccatgtgtactatcttggtcaacgaggcaagaagaatcctgcaacttt
ggataattctacgaacaattacggctatgatgatgaccgtgccgactatctggtggtcaa
tcgtgaccaccttgcattccgctatgagggatcattgcactggagagtcggtggccatca
agataatcaggaacaagaagcgtttccatcatcaagcacttgtagagatcaagattctag
acagcttgaggaaatgggacgcagacgagaagcaccacgttatcaagatgacggaacatt
tttactttagaaaccatctatgcatcgcaatggaactcttaagcattaacctttacgagt
taatcaaggcaaacgggtttgttggttttacgacggcgctcattcgacgcttcacgagcc
aaatgttgttgtccctttcgcttatgcgccatcatcgaattgtgcactgcgatttgaagc
ccgagaacgtccttcttcgccatccggccaagagcgcaatcaaggtcatcgacttcggaa
gtagttgcttcgagcacgagaagatctacacctacatccagagtcggttctatcggtccc
cagaagtcatcctaggcatgaactaccatatggccattgatatgntgagtctgggatgta
tcttggcagagctctacaccggcttccccatatttcctggggagatgagcangacagctt
tcatgtatcatggangttcttggcgtgcccgataa

DBGET integrated database retrieval system