KEGG   Moniliophthora perniciosa: MPER_03694Help
Entry
MPER_03694        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mpr  Moniliophthora perniciosa
Brite
Protein phosphatases and associated proteins [BR:mpr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     MPER_03694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 103 aa AA seqDB search
MIAIFDEDGGGSVDFQEFVGGLSAFSSRGGREEKLKFAFKVYDMDRDGYISNGELFLVLK
MMVGTNLKDQQLQQIVDKTIMEADKDGDGRLSFEEFATMVSNT
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgatagccattttcgatgaagatggtggaggctctgtggatttccaagaattcgtcggt
ggcctgagtgctttcagttcaaggggaggacgagaagaaaagttaaagtttgccttcaaa
gtatacgacatggacagagatggctatatatcgaatggtgaactcttcctagtattgaag
atgatggttggaacaaatctcaaggatcaacaactgcagcaaatagtggataagacaata
atggaagcagataaagatggagatgggagactgagttttgaagagtttgccacgatggtc
tcaaacacg

DBGET integrated database retrieval system