KEGG   Moniliophthora perniciosa: MPER_03962Help
Entry
MPER_03962        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpr  Moniliophthora perniciosa
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPER_03962
   00052 Galactose metabolism
    MPER_03962
   00500 Starch and sucrose metabolism
    MPER_03962
   00520 Amino sugar and nucleotide sugar metabolism
    MPER_03962
Enzymes [BR:mpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MPER_03962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 221 aa AA seqDB search
LQHMIDSGAEFIMEVTDKTKADVKGGTLIDYEGSIRLLEIAQVPSEHAEDFKSVRKFKIF
NTNNLWINLKALKRIMETEGMELEIIINPKMTDDGQAVIQLETAAGAAIKHFKNAHGINV
PRSRFLPVKSCSDLLLIKSDIYSLQHGQLVINEQRMFETTPVIKLGDHFKKIQQFQKRFK
KIPQILELDHLTVTGDVYFGRNVTLRGTVIGASLAYVRCLG
NT seq 664 nt NT seq  +upstreamnt  +downstreamnt
atcttcagcacatgatcgacagcggagcggaattcataatggaggtcaccgacaaaacca
aggccgacgtcaagggaggaactcttattgattatgagggttccattagattgctcgaaa
ttgcccaggttccgtcagaacacgccgaagacttcaagtcagtccggaaattcaagattt
tcaacaccaacaatttatggatcaatcttaaagcgctcaagcgcattatggaaaccgaag
gaatggagctcgagatcatcattaacccaaaaatgactgatgatggacaagcggtgatcc
agctcgagaccgccgccggtgcagcaattaagcacttcaagaacgcacatggaatcaacg
ttcctcgaagccgcttcttgcccgtgaagagctgctcagaccttcttctgatcaagagcg
atatttactcgttacagcatggtcaactcgtcatcaacgagcagaggatgtttgagacca
cccccgtaattaagttgggtgatcacttcaagaagattcaacaattccaaaagcgcttca
agaagattccccagattctcgagctggaccatttgacggttacgggcgacgtctactttg
ggaggaatgttacactcagggggacggttattggtgcgtcactggcctatgttcgctgct
tggg

DBGET integrated database retrieval system