KEGG   Moniliophthora perniciosa: MPER_04205Help
Entry
MPER_04205        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mpr  Moniliophthora perniciosa
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MPER_04205
Enzymes [BR:mpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MPER_04205
Exosome [BR:mpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MPER_04205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 137 aa AA seqDB search
MSVFQKVSRALKSVTSNDKPTKPAPQAPTKELKQGEFVGALDCGTTSVRFIIFDKHAXIV
AQHQLEFPQYYPQPGWHDHDPTEIQQHAEKCIDNAVKELETSGWARESVKVIGITNQRET
TVAWSRKTGQPLCKAGI
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtattccagaaagtctcccgggccttgaagtcggtcaccagcaacgacaaacct
actaaaccagccccgcaagctcccaccaaggagttgaaacaaggagagtttgtcggtgca
ttggattgtggaaccacttctgttcgtttcatcatattcgacaagcacgcgnacattgtc
gcccaacatcaactcgagttcccccaatattaccctcagcccggatggcatgaccacgac
cccactgaaatccaacagcatgctgagaaatgtatagacaatgcggtgaaggaattggaa
acttctggatgggctagggaaagcgtcaaggtcatcggaatcacgaatcagcgcgaaact
actgttgcatggagccgtaaaactggtcaaccgctatgcaaagctgggatctaa

DBGET integrated database retrieval system