KEGG   Moniliophthora perniciosa: MPER_04353Help
Entry
MPER_04353        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mpr  Moniliophthora perniciosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MPER_04353
Enzymes [BR:mpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MPER_04353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 111 aa AA seqDB search
GSSRFAEDLASAVQEARNNRTGEVRWWIIFFAPSAAQFVLPFIQEHFELPEETSNKSSNG
SKPVARVAAIGPTTDTYLRETLHLRVDAMAAKPTPEDLVSAIVSFDSRATL
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
ggctcgtccaggtttgcagaggatttggcgtctgctgtccaagaagcgcgaaataatcgt
actggcgaggttcgatggtggataatatttttcgctccttctgcggcacagtttgttctt
ccattcattcaagaacattttgagctgccagaagagacatcaaacaagtcttccaatggt
tcaaaacctgttgcacgggtagctgctattggacctactacagatacatatcttcgagag
acgctacacctccgtgtagatgcaatggctgcaaagcctaccccggaagatttagtatct
gcgatcgtgtcgttcgactcgagggcgaccttatga

DBGET integrated database retrieval system