KEGG   Moniliophthora perniciosa: MPER_04561Help
Entry
MPER_04561        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mpr  Moniliophthora perniciosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MPER_04561
Enzymes [BR:mpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MPER_04561
Exosome [BR:mpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MPER_04561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 215 aa AA seqDB search
MYIACDVCLCEYTNHGHCGVLHDDGTINTEPSVDRIAAVAVSYAKAGAHCVAPSDMMDGR
IKAIKRGLIDAGYGNKCTLMSYSAKFASSLYGPFRDAAGSAPSFGDRKCYQLPPAAKGLA
RRAIQRDAAEGADIIMVKPALPYLDIIADAAQLAPDHPLACYQVSGEFAMIHAGAKAGVY
DLRTMAFETVDSMIRAGATLILTYFTPDFLDWLEN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcgcctgtgatgtctgcttgtgcgaatacaccaatcatggacattgcggtgtt
ctccatgacgatggcacgatcaacacagagccttctgtagatcgtattgctgcagtagct
gtcagctatgccaaggccggtgctcattgcgttgctcctagcgacatgatggatgggcgt
atcaaggctatcaagagggggttgatagacgcaggctacgggaacaaatgcactctgatg
agctattctgcgaaattcgccagttccttgtatgggccattcagggatgctgcaggaagt
gcaccatcttttggtgatcgtaaatgctatcagctgccacctgcagcaaaaggattagct
cgaagggctattcaacgagatgctgcagagggcgcagatatcatcatggtcaagccggcg
ctcccgtacctagatatcattgcggatgcggcacagctcgccccagatcatccccttgcg
tgttaccaagtcagtggagagtttgccatgatccacgctggcgccaaggcaggcgtctac
gatctgcgtactatggccttcgagaccgtggatagcatgattcgagcaggtgcaactttg
attctcacatacttcactcctgatttcctggattggttggaaaactag

DBGET integrated database retrieval system