KEGG   Moniliophthora perniciosa: MPER_05060Help
Entry
MPER_05060        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
mpr  Moniliophthora perniciosa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MPER_05060
Messenger RNA biogenesis [BR:mpr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     MPER_05060
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     MPER_05060
Translation factors [BR:mpr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MPER_05060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 259 aa AA seqDB search
LRTSSTTSLNTTTSADSMSVNPPATRSTSPSALTVNDDGASTPSTTEGMVPPPGGDSTIT
TDKLERLQAQQDSTTPSPTIQPGKRVKGYKNIPSLDAITARLVRARTFSIDGSPKPPEPE
LIEDPKTPGLQMKPPEHPLQHSWTIYHDTKAKVPFTPTPQSTDGSAVAAFAAADQHEYEA
GLTVIGTFTTVEQFCRYFNWLKPPSKLERNSNYHWFKAPIKPMWEDPANANGGKWVLTMK
NNPNLLDRCWNWVAHGPCR
NT seq 782 nt NT seq  +upstreamnt  +downstreamnt
cccttcgtaccagttcaacgacctctctcaatacgacgacatcagcagactccatgtccg
tgaatccaccggccactcggagcacatcgccctccgcattgaccgtcaatgatgacgggg
catctacaccttccaccaccgaaggaatggtaccacctccaggtggcgattcgactatca
cgacagacaaactcgaaaggctccaagctcaacaagactcgactactcccagtccaacca
ttcaacccggcaaacgagtcaaagggtacaaaaacatcccttcactcgacgctataaccg
cacgactcgtcagagctcggaccttttccatcgacggatctcccaaaccacccgaaccag
agcttatcgaagaccccaagacacccggtctccagatgaaaccgccggaacacccgttac
aacattcatggacgatttatcacgatacaaaggccaaagtgccatttacgcctacccctc
agagcaccgatgggtctgcagtagcggcgtttgcggctgcggaccagcacgagtatgaag
ctggattgacggttattggaacatttactactgtggagcagttttgccggtactttaact
ggttaaagccgccgagcaagttggagaggaatagtaattatcattggttcaaggcaccga
ttaagccgatgtgggaggatccggcgaatgctaatggtggcaaatgggtattgacgatga
agaataatcccaatctactggatagatgctggaattgggtagcccatggcccttgtcggt
ga

DBGET integrated database retrieval system