KEGG   Moniliophthora perniciosa: MPER_05095Help
Entry
MPER_05095        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
mpr  Moniliophthora perniciosa
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MPER_05095
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     MPER_05095
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     MPER_05095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 188 aa AA seqDB search
MRAYYFDNIPGDQRLPHDCNPSREVTEIHLKTLNVETFHIPLEGYQEKIDAMAARRNYRN
RDVINISREGLGEAYEDKIKAFFHEHLHEDEEIRYILSGSGYFDVRETPSDAWIRIAMDP
GDLLVLPAGIYHRFTLDENDNVQAMRLFKDEHKWAAVHRGPEAKHNIHRLDYLKSIAPVG
LMATSFVL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcatactactttgataacatccccggagaccaacgtcttcctcacgattgcaat
ccatctcgggaggtgacggagatacacctcaagaccctgaatgtcgagacctttcatatc
cctttggaagggtaccaggagaagatagatgctatggcggcgaggaggaactataggaac
agggatgtgatcaatatctccagggaaggactcggtgaagcatatgaggacaaaataaaa
gccttcttccacgagcaccttcatgaagacgaagaaattcgctacattctttcgggaagc
ggctactttgacgttcgggaaacaccttcagatgcttggatccgcatcgcgatggatcca
ggagacctgttggttcttccggctgggatttatcatcgtttcacattggacgagaatgat
aacgttcaagccatgagactttttaaggacgagcacaagtgggcagctgttcaccgaggt
ccggaggcaaaacataatattcatcgtcttgattatctgaagagtattgcaccggttggc
ttgatggctacctccttcgtattgtaa

DBGET integrated database retrieval system