KEGG   Moniliophthora perniciosa: MPER_05684Help
Entry
MPER_05684        CDS       T01089                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpr  Moniliophthora perniciosa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPER_05684
   01230 Biosynthesis of amino acids
    MPER_05684
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPER_05684
   00030 Pentose phosphate pathway
    MPER_05684
   00051 Fructose and mannose metabolism
    MPER_05684
   00052 Galactose metabolism
    MPER_05684
  Energy metabolism
   00680 Methane metabolism
    MPER_05684
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MPER_05684
Enzymes [BR:mpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MPER_05684
Protein phosphatases and associated proteins [BR:mpr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MPER_05684
Messenger RNA biogenesis [BR:mpr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MPER_05684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 183 aa AA seqDB search
KITKEQATTNAHLKIAGLVGSIDNDMSMTDLTIGAPTALYRICEAIDNINSTAASHSRAF
VLEVMGRHCGWLALLAGVSGGADFIFIPERPPTADSWEDEMCECIHRHREVGKRKTIVII
AEGAHDKNLNPIKADYVKDVLTERLGLDTRVTTLGHTQRGGRPCAFDRILVSTASSGQRI
KFK
NT seq 554 nt NT seq  +upstreamnt  +downstreamnt
caaaaataacgaaagagcaagctactaccaatgctcatctgaaaatagctggacttgttg
gatctattgacaacgatatgtcgatgacagatctaactatcggtgctccaaccgccttat
accgtatctgcgaagctattgataacatcaactccacggccgctagtcattcacgggcat
tcgtgttagaggtcatgggaagacactgtggatggttggcactgcttgccggcgttagcg
gtggtgcagactttatatttatccccgagcgcccaccaacggcagattcctgggaggacg
agatgtgcgaatgtatccatcgtcatcgtgaagtcggaaaacgcaaaacgattgtcatta
ttgccgagggagcccatgacaagaacctaaaccccatcaaagcggactacgtgaaggacg
tgctcacggagcgcttgggattggatacgcgtgttaccactcttggtcatacccagagag
gagggagaccttgcgcattcgatcgcattttggtgagtaccgcgagttcgggtcagagga
tcaagtttaaataa

DBGET integrated database retrieval system