KEGG   Moniliophthora perniciosa: MPER_05734Help
Entry
MPER_05734        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MPER_05734
Peptidases [BR:mpr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MPER_05734
Transcription machinery [BR:mpr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MPER_05734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 221 aa AA seqDB search
MKEKGDSASGENTLGACLRRYTQPEKLGNKEYSCDKCRKATHDASKRLSIRKLPPVLSFQ
FKRFEHKTSEKSSAAARKLDSVIRFPASLNMMPYTTYAIRESTEKENMAAMGPEVMYEYD
LFAVINHDGQINNGHYTTFARSQDEWYRFDDDKITHATLGECLKSSAYMCFYVKRHLEYK
PHMTPAYVLTREAEAIREKEMEKEKEAARMKEVEDALLATV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaaaggagattccgcatccggggaaaataccctgggggcttgcctacgaagg
tacactcagcctgagaaactcggcaataaagaatacagttgcgataagtgccgtaaagcc
actcatgacgctagcaagcgtttgagcatacgcaagctaccaccggtcctgagcttccag
ttcaagcggttcgagcataaaacttcggagaagtcatccgcagccgctcgaaagctagac
tccgtgatacggtttccggcgtcactcaacatgatgccatacaccacgtatgccattaga
gaatcgacagagaaggagaacatggcggcgatggggccagaggtaatgtacgagtatgat
ctatttgcagtcatcaaccacgacggccaaataaataacgggcactacacgacttttgct
cgctctcaggacgagtggtacagatttgacgatgacaaaatcacgcatgcaacattgggt
gaatgcctcaaatcttcggcgtatatgtgcttctatgtaaagcggcacttggagtataag
cctcacatgactccagcctacgtgctcaccagagaggcagaggcgattagagagaaagaa
atggaaaaagagaaagaggccgctcgtatgaaggaggtagaagatgccttgttggcaacc
gtatga

DBGET integrated database retrieval system