KEGG   Moniliophthora perniciosa: MPER_05906Help
Entry
MPER_05906        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPER_05906
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MPER_05906
Enzymes [BR:mpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MPER_05906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 198 aa AA seqDB search
MLVIARTDAESGKLISSVVDIEDQEFILGTTTPGKPLAQILAEATMSGASGPEIDRLEKD
WTDEHHLVTFNQAVEAAIKDSTISDKEAAYKAYLTAASGRSTVDAREIAKDILGASVFWD
CDMPRTREGYYHMTGGLEPAIKRAITFAPYADLLWLETKAPNIEEARYFARKIREKHPGK
WVVYNLSPSFNWSAHGFS
NT seq 595 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttattgcaaggacggatgctgaatccggcaaattaatctcatcggtggttgac
attgaggatcaagagttcatactcggaacgactacaccaggaaaacctctagctcagatt
ttggctgaggcaacaatgagtggtgcatcaggtcccgagatcgatcgccttgaaaaggat
tggactgacgagcatcatctggttaccttcaatcaagccgtggaagccgcaatcaaggat
tccacaatcagcgacaaagaggctgcatacaaagcttaccttaccgctgcttcaggcaga
tctaccgtcgacgctcgcgagatagccaaagacattctaggagctagtgttttctgggat
tgtgatatgcctcgcacgcgtgaaggatactaccacatgactggtggccttgaacctgct
atcaaacgcgcgataacctttgcaccttacgccgacctgctttggttggaaacgaaggcg
ccgaacattgaggaagccagatattttgcacgcaagattcgcgaaaagcaccctggaaag
tgggttgtatacaacttgagtcctagcttcaactggtccgcacatggcttctccg

DBGET integrated database retrieval system