KEGG   Moniliophthora perniciosa: MPER_06035Help
Entry
MPER_06035        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mpr  Moniliophthora perniciosa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPER_06035
Enzymes [BR:mpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MPER_06035
Exosome [BR:mpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MPER_06035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 244 aa AA seqDB search
MDNHEAVMTNSHKGYDKFGFNVGENDEVVYREWAPNAKEAYFIGEFNDWNRTSHPMIRDN
FGVWEITVTPKSPGVCAIPHDSKIKISMVLPSGERIERLPAWIKRVTQDLNVSPVYDARF
WNPPKSEQYTFKNARPPPVKGARIYEAHVGISTSEPRVGTYKEFTKNVLPRIKKLGYNVI
QLMAIMEHAYYACVVVLAFGSLVLICTLNQAFGYQVTNFFAASSGDKQPEDLKELIDTAH
AMCL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccacgaggcggttatgacaaattcacacaagggttacgataaattcggcttc
aatgttggggaaaatgatgaggtagtgtacagagaatgggcacctaatgccaaagaagca
tatttcattggagagttcaatgattggaataggacttcccatcctatgataagagacaat
ttcggtgtttgggagatcacggtaaccccaaaatcgccaggtgtatgcgccattccccat
gactccaagatcaaaatttcgatggttctcccttctggtgaacgtatcgaacgtcttcct
gcttggatcaagcgtgttacccaagatttgaacgtatcccctgtgtatgacgcacgcttc
tggaatcctcccaaatctgaacagtacaccttcaaaaacgcacgacctcccccagtcaaa
ggcgccagaatctatgaagctcatgttggtatctccacttcagagccacgcgtagggacc
tacaaagagtttaccaaaaatgtccttcctcgtatcaagaagctcggatacaacgtcatc
cagctcatggctataatggagcacgcatactacgcttgtgtcgttgtcttggcttttgga
agtctagtgctcatctgtaccttgaaccaagcattcggctaccaggttaccaatttcttc
gcagccagttctggggacaaacaaccagaagatttgaaagaacttattgatactgctcat
gccatgtgtctg

DBGET integrated database retrieval system