KEGG   Moniliophthora perniciosa: MPER_06441Help
Entry
MPER_06441        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MPER_06441
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MPER_06441
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MPER_06441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 186 aa AA seqDB search
LRSIPAAASTFAAFELTRAHMQLMEYGNGVRTILNFRWCRAFVFAALAAVIPNQARRKAL
PRGYLITTRGAPDPAEWKSLTSPFANNTAAIVGCPFRGGQPRLGVDKGPIHLVEAGLIDQ
LKELGWNVKFDGHHQFEEITAQNDPPIGKLKNPRFVSHVCRSVANVIGEHAKKGELPVAL
GGDHSL
NT seq 560 nt NT seq  +upstreamnt  +downstreamnt
tgttacgaagtatacccgctgctgcaagtacatttgctgcgtttgagctgactagagcgc
acatgcagcttatggaatatggaaatggggttcgaaccatactcaacttccggtggtgtc
gggcatttgtctttgctgccttagctgctgttattccaaatcaagcgaggagaaaagctc
tgcctcgaggttatctgatcaccacacgtggtgcgccggacccagcggaatggaaatcct
tgacgtcgccctttgcgaacaatactgctgctattgtcggatgccctttcaggggtggcc
agccaagactcggtgtagacaaaggaccaatccatctcgtagaagcaggtctcatcgacc
aactcaaggagctcggatggaatgtcaagtttgacggacatcaccaatttgaggaaatca
cggcccagaatgatcctcccattggaaagctgaagaacccgagattcgtttcgcatgtat
gtcgatccgtggcgaatgttattggagagcatgccaagaagggagagcttccggtggcgc
ttggtggtgatcattcattg

DBGET integrated database retrieval system