KEGG   Moniliophthora perniciosa: MPER_06441Help
Entry
MPER_06441        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00220  Arginine biosynthesis
mpr00330  Arginine and proline metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
mpr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MPER_06441
   00330 Arginine and proline metabolism
    MPER_06441
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MPER_06441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: EEB94702
UniProt: E2LIP9
AA seq 186 aa AA seqDB search
LRSIPAAASTFAAFELTRAHMQLMEYGNGVRTILNFRWCRAFVFAALAAVIPNQARRKAL
PRGYLITTRGAPDPAEWKSLTSPFANNTAAIVGCPFRGGQPRLGVDKGPIHLVEAGLIDQ
LKELGWNVKFDGHHQFEEITAQNDPPIGKLKNPRFVSHVCRSVANVIGEHAKKGELPVAL
GGDHSL
NT seq 560 nt NT seq  +upstreamnt  +downstreamnt
tgttacgaagtatacccgctgctgcaagtacatttgctgcgtttgagctgactagagcgc
acatgcagcttatggaatatggaaatggggttcgaaccatactcaacttccggtggtgtc
gggcatttgtctttgctgccttagctgctgttattccaaatcaagcgaggagaaaagctc
tgcctcgaggttatctgatcaccacacgtggtgcgccggacccagcggaatggaaatcct
tgacgtcgccctttgcgaacaatactgctgctattgtcggatgccctttcaggggtggcc
agccaagactcggtgtagacaaaggaccaatccatctcgtagaagcaggtctcatcgacc
aactcaaggagctcggatggaatgtcaagtttgacggacatcaccaatttgaggaaatca
cggcccagaatgatcctcccattggaaagctgaagaacccgagattcgtttcgcatgtat
gtcgatccgtggcgaatgttattggagagcatgccaagaagggagagcttccggtggcgc
ttggtggtgatcattcattg

DBGET integrated database retrieval system