KEGG   Moniliophthora perniciosa: MPER_07179Help
Entry
MPER_07179        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00511  Other glycan degradation
mpr00513  Various types of N-glycan biosynthesis
mpr00520  Amino sugar and nucleotide sugar metabolism
mpr00531  Glycosaminoglycan degradation
mpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MPER_07179
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    MPER_07179
   00531 Glycosaminoglycan degradation
    MPER_07179
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    MPER_07179
   00604 Glycosphingolipid biosynthesis - ganglio series
    MPER_07179
   00511 Other glycan degradation
    MPER_07179
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MPER_07179
Chaperones and folding catalysts [BR:mpr03110]
 Intramolecular chaperones
  Others
   MPER_07179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20
Motif
Other DBs
NCBI-ProteinID: EEB94073
UniProt: E2LKH8
AA seq 293 aa AA seqDB search
MHLHTYAVPDVKRLLDAMSWVKSWPLGITEFPELAAKGAYSAGETFSPDDIQDLVTYAAE
RGIDVIMEIDNPGHTAIVGASHPEHVACYEGTGRTVGEPPAGQLRLASDATLNFTLDVLS
SVAKSLPSKFFATGGDEVNVPCYDQDEQTQQELSSSGRTLEEALGDFVDATHDMLRSIGK
TPVVWEEMVLEHNITLKNDTVALVWISSQHAASIVAKDIRIIHAPSDYFYLDCGGGGWLG
GDTGDSWCDPFKSWQRAYTFDPLANITAEQQHLVLGVLIVDGGQINRATALVE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgcatacttacgctgttcctgatgtcaagagactgcttgatgccatgagctgg
gtcaagagttggcctcttgggataaccgagttcccagaacttgctgcgaaaggtgcctac
tcggccggagaaacgttctctcccgatgatattcaagaccttgtcacctatgctgccgag
aggggtatcgatgttattatggaaattgataatcccggacatacagctattgtcggagcg
tcacacccagaacatgtcgcgtgttatgaaggtaccggaaggacagtcggcgaaccacct
gcaggacaacttcgtcttgcttctgatgcaacattgaactttacgcttgatgtgttgtcc
tctgttgccaaatcgttgccatccaagttcttcgctactgggggtgatgaagtcaatgtc
ccttgctatgatcaggacgagcaaactcaacaagagttgtccagtagcggaaggactcta
gaagaggcactgggtgatttcgtggatgctacgcatgatatgcttaggagtatagggaag
acacccgtagtatgggaagaaatggttttggagcataacatcacgttgaagaatgacacg
gttgcgctcgtatggatatcatcccagcatgcagcgtcaattgtcgccaaagatattcgt
atcatccacgcgccctctgattacttctatctcgactgcggtggagggggatggttaggt
ggggataccggagatagttggtgtgaccctttcaagagctggcagcgggcgtataccttt
gatccattagccaacattaccgctgaacagcagcatctggttctcggagttcttattgtt
gatggtggtcaaataaatagggcaacagctcttgtggag

DBGET integrated database retrieval system