KEGG   Moniliophthora perniciosa: MPER_07642Help
Entry
MPER_07642        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mpr  Moniliophthora perniciosa
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    MPER_07642
Enzymes [BR:mpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     MPER_07642
Glycosyltransferases [BR:mpr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   MPER_07642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 196 aa AA seqDB search
NEVSGYGFPGFEGDGNDDWFLEIDHGDKRDRESHKRLRTLRTKFRLRHALTGCYLFSHKV
KLPEWGFEQQEVTCNKNAVRDNSLWMIETAAHPGLPADAPKVNYRLPGFLSKFLELQQVM
WTTNAGLTDRHTFDSRPDSWPRLRRGINFWVKDHRQIYLIGNPWVWWLSTAAVFAYARYT
WSTHLEGQERIQGLQQ
NT seq 590 nt NT seq  +upstreamnt  +downstreamnt
aacgaggtgtcgggttatggattccctgggttcgagggtgatgggaatgatgattggttc
ctcgagatcgaccacggagacaaacgagatcgggagagccacaagaggttgaggaccttg
aggaccaagtttaggctaaggcatgccttgacaggctgttatctcttctcccacaaggtc
aagttaccagaatggggtttcgagcaacaggaagtcacctgtaacaagaacgcagtcaga
gacaactcgctatggatgattgagacggctgcgcatcctggactgccagccgacgcgcca
aaagtcaactaccgattgcctggtttcttgtccaagttccttgaactgcaacaagtcatg
tggacgacgaatgctggtttaacggaccgccatacattcgactctcgacctgattcctgg
cctcgcctccgtcgtggaatcaacttttgggtaaaggatcatcgccagatttatctgatt
ggcaacccctgggtgtggtggctaagcaccgctgccgtttttgcctatgcccgctatacg
tggtctactcatcttgagggccaagagaggatacaaggacttcaacaaca

DBGET integrated database retrieval system