KEGG   Moniliophthora perniciosa: MPER_07653Help
Entry
MPER_07653        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mpr  Moniliophthora perniciosa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPER_07653
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MPER_07653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 144 aa AA seqDB search
GFNFFRVPFQLERLTPPSVGITGSFDSAYFADLQSTVNYITNKGATVAIEPHNFLIYNGA
TLSNTAHLEESRKQVYLMNEPHDVPATQVAAMMQAGINGVRSAGATSQLILVEGTSWTGA
WTWTSSGNAAAFTNLQDPNDNFAI
NT seq 433 nt NT seq  +upstreamnt  +downstreamnt
ggcttcaactttttccgcgttcctttccaactggaacgattgaccccaccttccgttggt
atcactgggtctttcgacagtgcttactttgctgacctgcaatctacggtcaactacatt
acgaacaagggagccactgttgcaattgaaccccacaatttcctcatctacaatggcgct
actttgagtaatacagcacatctggaagaatctcgcaagcaggtttacttgatgaatgag
ccacacgatgtgcctgccacccaagttgccgccatgatgcaagccggtatcaatggtgtc
aggtcagctggtgcaacttcccaactcattctagttgaagggacatcttggactggcgct
tggacttggaccagctcgggcaacgctgccgcatttactaacctccaggatcctaacgac
aactttgctattg

DBGET integrated database retrieval system