KEGG   Moniliophthora perniciosa: MPER_07716Help
Entry
MPER_07716        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MPER_07716
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MPER_07716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Abhydrolase_6 FSH1 DLH Hydrolase_4 Nuc_deoxyri_tr2 Peptidase_S9 Esterase Lipase_3 Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: EEB93599
UniProt: E2LLV2
AA seq 233 aa AA seqDB search
MITELEAQEIVHVPARSAEEKKASVIFLHGLGHSNLTWKEVVTEALAPRLPNVQWILPQA
PHQPVTLNQGTLRPSWFDIAHLPPQKDEWDETTIAESITRIENIVLREVHSGIESSRIVL
VGFSQGAALSLMTALSTLHELGGVASLSGWIPHAARSSGTLIHAGDTKMPILWCHGTSDT
EIPLSMGIDAVEYLKSDAVQLSKVNMKTYDGLEHRICDEELADLADWLEGVLK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagagttggaggcgcaagaaattgtccatgtaccagcaagatcagccgaagag
aagaaggcgtcggtcatttttcttcacggcttgggccattccaatctcacctggaaagaa
gttgtcactgaggcattggctcctcgcttgccgaatgtgcaatggattctaccccaagct
ccgcatcaacctgttactttgaatcaaggcacgctccgtccaagctggttcgatatcgcc
catctaccgccacaaaaggatgaatgggacgaaaccacaatagcggaatccattacgcga
attgagaacatcgttcttcgagaagttcattcgggcattgaaagtagccgaatcgttcta
gtcggattcagtcaaggggctgctctcagcttgatgacagcgctttctacgttgcatgag
cttggaggggtagccagtctatccggctggatccctcatgctgctcgttcatcggggacg
ctaattcacgcaggcgacaccaaaatgcccattctttggtgccatggtacatctgacact
gaaatacccttgtccatgggaatagacgccgtggaatacctcaaatcggatgctgttcag
ctatcaaaagtgaatatgaaaacttacgatggcttagagcatagaatctgcgacgaggaa
ctagcggacttggcggactggctggaaggcgttttgaaatga

DBGET integrated database retrieval system