KEGG   Moniliophthora perniciosa: MPER_07716Help
Entry
MPER_07716        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
mpr  Moniliophthora perniciosa
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MPER_07716
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MPER_07716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 233 aa AA seqDB search
MITELEAQEIVHVPARSAEEKKASVIFLHGLGHSNLTWKEVVTEALAPRLPNVQWILPQA
PHQPVTLNQGTLRPSWFDIAHLPPQKDEWDETTIAESITRIENIVLREVHSGIESSRIVL
VGFSQGAALSLMTALSTLHELGGVASLSGWIPHAARSSGTLIHAGDTKMPILWCHGTSDT
EIPLSMGIDAVEYLKSDAVQLSKVNMKTYDGLEHRICDEELADLADWLEGVLK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagagttggaggcgcaagaaattgtccatgtaccagcaagatcagccgaagag
aagaaggcgtcggtcatttttcttcacggcttgggccattccaatctcacctggaaagaa
gttgtcactgaggcattggctcctcgcttgccgaatgtgcaatggattctaccccaagct
ccgcatcaacctgttactttgaatcaaggcacgctccgtccaagctggttcgatatcgcc
catctaccgccacaaaaggatgaatgggacgaaaccacaatagcggaatccattacgcga
attgagaacatcgttcttcgagaagttcattcgggcattgaaagtagccgaatcgttcta
gtcggattcagtcaaggggctgctctcagcttgatgacagcgctttctacgttgcatgag
cttggaggggtagccagtctatccggctggatccctcatgctgctcgttcatcggggacg
ctaattcacgcaggcgacaccaaaatgcccattctttggtgccatggtacatctgacact
gaaatacccttgtccatgggaatagacgccgtggaatacctcaaatcggatgctgttcag
ctatcaaaagtgaatatgaaaacttacgatggcttagagcatagaatctgcgacgaggaa
ctagcggacttggcggactggctggaaggcgttttgaaatga

DBGET integrated database retrieval system