KEGG   Moniliophthora perniciosa: MPER_07818Help
Entry
MPER_07818        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mpr  Moniliophthora perniciosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 192 aa AA seqDB search
AHRVSRDIPLPLVTSGCENSGNLRELALNRMKDFGAVCIDVRFREGGIHDIHHKVRSESV
ELLRRDYTANGGWETFLSYEDPERDILIGLLRLRKCSEEGTFRPELVRTEEGGCSIVREL
HVYGTAVPVHGRDPTKFPHQGVGTLLMEEAERIAREEHGSVKLAVISGVGTRDYYRKLGY
ELDGPYMSKSLL
NT seq 580 nt NT seq  +upstreamnt  +downstreamnt
tgctcatcgtgtatctagagatattcctttaccactggtcacaagtggctgcgaaaactc
tggcaatcttcgcgaactggctctcaatcggatgaaggatttcggcgctgtatgtataga
cgttcggttccgagaaggtgggatccacgacatacaccataaagtgcggtcagaatcagt
cgagcttcttcgtagagattacacagccaatggcggatgggaaacttttctttcatacga
agatccggaacgagatatcctgattggactgctacgattgcgaaaatgttctgaagaggg
tactttccgacctgagctggtgagaacggaggaaggcggatgcagtatagtcagagaact
acacgtgtatggcactgcagttcctgtgcatgggagagatccaacgaaattcccacatca
gggagtcgggacgctcctgatggaggaagccgagcgtattgcacgagaagagcatggtag
tgtgaagttggcagtcatttcgggggttggcacgcgcgactattaccgcaaactagggta
cgagcttgatggcccatacatgagtaagtcattattgtaa

DBGET integrated database retrieval system