KEGG   Moniliophthora perniciosa: MPER_07818Help
Entry
MPER_07818        CDS       T01089                                 

Definition
(RefSeq) hypothetical protein
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MPER_07818
Transfer RNA biogenesis [BR:mpr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MPER_07818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 192 aa AA seqDB search
AHRVSRDIPLPLVTSGCENSGNLRELALNRMKDFGAVCIDVRFREGGIHDIHHKVRSESV
ELLRRDYTANGGWETFLSYEDPERDILIGLLRLRKCSEEGTFRPELVRTEEGGCSIVREL
HVYGTAVPVHGRDPTKFPHQGVGTLLMEEAERIAREEHGSVKLAVISGVGTRDYYRKLGY
ELDGPYMSKSLL
NT seq 580 nt NT seq  +upstreamnt  +downstreamnt
tgctcatcgtgtatctagagatattcctttaccactggtcacaagtggctgcgaaaactc
tggcaatcttcgcgaactggctctcaatcggatgaaggatttcggcgctgtatgtataga
cgttcggttccgagaaggtgggatccacgacatacaccataaagtgcggtcagaatcagt
cgagcttcttcgtagagattacacagccaatggcggatgggaaacttttctttcatacga
agatccggaacgagatatcctgattggactgctacgattgcgaaaatgttctgaagaggg
tactttccgacctgagctggtgagaacggaggaaggcggatgcagtatagtcagagaact
acacgtgtatggcactgcagttcctgtgcatgggagagatccaacgaaattcccacatca
gggagtcgggacgctcctgatggaggaagccgagcgtattgcacgagaagagcatggtag
tgtgaagttggcagtcatttcgggggttggcacgcgcgactattaccgcaaactagggta
cgagcttgatggcccatacatgagtaagtcattattgtaa

DBGET integrated database retrieval system