KEGG   Moniliophthora perniciosa: MPER_07943Help
Entry
MPER_07943        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
mpr  Moniliophthora perniciosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 155 aa AA seqDB search
DGEKKKRKKARKETYSSYIYKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLAT
YSKKSTISSREIQTSVRLILPGELAKHAISEGTKSVTKYSAGTKILEAWAIFSSNASRFT
YASLSMVASWCREQCKESITRELTVIFIWGFSGAP
NT seq 470 nt NT seq  +upstreamnt  +downstreamnt
ccgacggcgagaagaaaaagcgcaagaaggccagaaaggagacctacagttcttatatct
acaaggtcttgaagcaagtccaccctgacactggtatttctaacaaggcgatggctattc
ttaactcgttcgtcaacgatatcttcgagcgtatcgctaccgaggcttccaagttggcca
cgtactccaagaaatcaactatctcctcccgtgaaatccagaccagcgtccgcctcatcc
ttcctggtgagctcgctaagcacgccatatccgaaggcacgaagtcggtaaccaaatact
ctgctggtaccaaaatcctagaggcttgggcaatcttctcttccaatgcttcccggttca
catatgcttcattgagcatggttgccagctggtgtcgtgaacaatgcaaggaatccatca
ccagggagctcaccgttatattcatctggggtttctccggtgcaccttga

DBGET integrated database retrieval system