KEGG   Moniliophthora perniciosa: MPER_08012Help
Entry
MPER_08012        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
mpr  Moniliophthora perniciosa
Brite
Protein kinases [BR:mpr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   MPER_08012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 272 aa AA seqDB search
MPVCSDWFKEAIHYMFLSGDYRESRKVLLNIEYRLMLQMAPDYENLTLLQKVEVFEYALE
NTTGQDLYRVLWLKSQNSEHWLERRVSYTRSLAVNSMVGHILGLGDRHPSNILVERSTGK
VINIDFGDCFEIATLRDKFPETVPFRLTRMLTHAMEVGGIEGSFRNTCEITMKVLRDNKE
SLMAVLEAFVYDPLISWRLMQTNEGKRIDDNTTELARAAAHPQGPGRRKLRADENDIFRE
AGGASAGGDHLGREVRDLRAGSVYQPVQKKLK
NT seq 817 nt NT seq  +upstreamnt  +downstreamnt
atgccggtctgctcggattggttcaaggaagcgatacattacatgttcttgtcaggggat
tatcgtgaatctaggaaggtgcttcttaatatcgaatatcgtctgatgcttcagatggcg
cctgactacgagaatctcaccctccttcaaaaagtagaagtgttcgaatacgcgctggag
aacacgaccggtcaagacctttacagagttttatggctgaagagtcagaattcagaacac
tggcttgagagacgggtatcatatactcgctctttggctgtgaacagcatggttgggcac
attttaggtctgggagaccgtcatccttccaatatactcgttgaacgaagcacgggcaaa
gtcatcaatatcgattttggcgattgtttcgagattgcaaccttgcgagataaattccct
gagacggttccattcaggcttactaggatgctgacacatgctatggaggtgggaggcatc
gaaggcagcttccgtaacacatgcgaaatcacaatgaaagtgcttcgagacaacaaagag
tctttgatggctgttcttgaggcattcgtgtatgatccgctcatcagctggaggcttatg
cagacaaatgaagggaagcggattgatgataatactactgaacttgcccgcgccgcagcc
catcctcaaggtcctggccgcagaaaactaagggctgatgagaacgacatcttccgagag
gccggtggagcatctgccggtggagatcatctcggacgagaggttcgcgatcttcgtgca
gggtccgtgtaccaacccgtgcagaaaaaacttaagg

DBGET integrated database retrieval system